StarFunc result for job id O43676

User Input

>input (98 residues)
MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKS
VSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43676	1.000	1.000	3.958E-17	98	1.000	1.000	O43676.pdb.gz	NDUB3_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 OS=Homo sapiens OX=9606 GN=NDUFB3 PE=1 SV=3
2	AFDB:Q02365	0.907	0.907	3.733E-14	98	0.827	0.827	Q02365.pdb.gz	NDUB3_BOVIN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 OS=Bos taurus OX=9913 GN=NDUFB3 PE=1 SV=2
3	AFDB:Q9CQZ6	0.886	0.837	6.457E-14	104	0.806	0.760	Q9CQZ6.pdb.gz	NDUB3_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 OS=Mus musculus OX=10090 GN=Ndufb3 PE=1 SV=1
4	PDB:7qskk	0.765	0.920	4.457E-11	81	0.673	0.815	7qskk.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
5	PDB:7ak5k	0.749	0.932	4.575E-10	78	0.643	0.808	7ak5k.pdb.gz	Structural basis for a complex I mutation that blocks pathological ROS production.
6	AFDB:Q2GJ94	0.161	0.067	1.799	363	0.143	0.039	Q2GJ94.pdb.gz	Q2GJ94_ANAPZ Putative membrane protein OS=Anaplasma phagocytophilum (strain HZ) OX=212042 GN=APH_0995 PE=3 SV=1
7	AFDB:C8V0H5	0.155	0.097	2.905	187	0.153	0.080	C8V0H5.pdb.gz	C8V0H5_EMENI Transport protein particle (TRAPP) complex subunit TRS33, putative (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10826 PE=3 SV=1
8	AFDB:P53077	0.275	0.238	3.568	123	0.214	0.171	P53077.pdb.gz	MTC3_YEAST Maintenance of telomere capping protein 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTC3 PE=1 SV=1
9	PDB:6giqe	0.242	0.245	3.939	96	0.163	0.167	6giqe.pdb.gz	Cryo-EM structure of the yeast respiratory supercomplex.
10	PDB:6t9iC	0.206	0.117	4.517	214	0.082	0.037	6t9iC.pdb.gz
11	AFDB:P38880	0.145	0.045	4.692	579	0.092	0.016	P38880.pdb.gz	MDM31_YEAST Mitochondrial distribution and morphology protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDM31 PE=1 SV=1
12	PDB:1ss3A	0.173	0.298	5.548	50	0.092	0.180	1ss3A.pdb.gz
13	PDB:7dvq2	0.153	0.083	5.548	216	0.143	0.065	7dvq2.pdb.gz	Structure of the activated human minor spliceosome.
14	AFDB:P00424	0.247	0.184	5.763	153	0.153	0.098	P00424.pdb.gz	COX5A_YEAST Cytochrome c oxidase subunit 5A, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX5A PE=1 SV=1
15	AFDB:Q21272	0.340	0.163	7.077	257	0.163	0.062	Q21272.pdb.gz	PAX1H_CAEEL Paired box protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=pax-1 PE=2 SV=1
16	PDB:5z0rB	0.190	0.052	7.296	445	0.143	0.031	5z0rB.pdb.gz	Structural insight into the Zika virus capsid encapsulating the viral genome.
17	PDB:7ohrI	0.294	0.078	7.296	409	0.122	0.029	7ohrI.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
18	PDB:6lthM	0.169	0.083	8.367	259	0.082	0.031	6lthM.pdb.gz	Structure of nucleosome-bound human BAF complex.
19	AFDB:Q582W0	0.182	0.040	8.691	604	0.092	0.015	Q582W0.pdb.gz	Q582W0_TRYB2 Pumilio/PUF RNA binding protein 8, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.410 PE=4 SV=1
20	PDB:6fpgF	0.127	0.063	8.960	266	0.041	0.015	6fpgF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43676	2.94e-69	203	98	1.000	1.000	NDUB3_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 OS=Homo sapiens OX=9606 GN=NDUFB3 PE=1 SV=3
2	Q02365	3.51e-57	173	98	0.827	0.827	NDUB3_BOVIN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 OS=Bos taurus OX=9913 GN=NDUFB3 PE=1 SV=2
3	Q9CQZ6	7.58e-50	154	104	0.714	0.673	NDUB3_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 OS=Mus musculus OX=10090 GN=Ndufb3 PE=1 SV=1
4	Q9LJM6	4.2	28.5	491	0.153	0.031	Q9LJM6_ARATH Uncharacterized protein At3g19680 OS=Arabidopsis thaliana OX=3702 GN=At3g19680 PE=1 SV=1
5	A8VZX9	4.8	28.5	1769	0.102	0.006	A8VZX9_AGRRH Rcorf28 OS=Agrobacterium rhizogenes OX=359 PE=1 SV=1
6	O97363	9.7	27.3	313	0.163	0.051	O97363_BOMMO Lipopolysaccharide binding protein OS=Bombyx mori OX=7091 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08122 NDUF_B12	1.8e-19	80.7	NADH-ubiquinone oxidoreductase B12 subunit family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000237889

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000184266	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
2	9606.ENSP00000215565	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
3	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
4	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
5	9606.ENSP00000252711	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
6	9606.ENSP00000259037	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
7	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
8	9606.ENSP00000268668	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
9	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
10	9606.ENSP00000330737	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
11	9606.ENSP00000360492	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
12	9606.ENSP00000362060	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
13	9606.ENSP00000362873	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
14	9606.ENSP00000369176	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
15	9606.ENSP00000389160	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
16	9606.ENSP00000417142	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
17	9606.ENSP00000418842	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
18	9606.ENSP00000423673	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
19	9606.ENSP00000458770	0.999	Acyl carrier protein, mitochondrial
20	9606.ENSP00000263774	0.998	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008137	0.999	NADH dehydrogenase (ubiquinone) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006119	0.987	oxidative phosphorylation
GO:0032981	0.987	mitochondrial respiratory chain complex I assembly
GO:0022900	0.968	electron transport chain
GO:0022904	0.925	respiratory electron transport chain
GO:0042775	0.916	mitochondrial ATP synthesis coupled electron transport
GO:0019646	0.915	aerobic electron transport chain
GO:0006120	0.913	mitochondrial electron transport, NADH to ubiquinone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005747	0.998	mitochondrial respiratory chain complex I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29091	0.999	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	0.999	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]