StarFunc result for job id O43680

User Input

>input (179 residues)
MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRR
KAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDT
LRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35437	0.911	0.911	1.599E-23	179	0.961	0.961	O35437.pdb.gz	TCF21_MOUSE Transcription factor 21 OS=Mus musculus OX=10090 GN=Tcf21 PE=2 SV=1
2	AFDB:Q6GNB7	0.620	0.620	1.081E-21	179	0.860	0.860	Q6GNB7.pdb.gz	TCF21_XENLA Transcription factor 21 OS=Xenopus laevis OX=8355 GN=tcf21 PE=2 SV=1
3	AFDB:Q32PV5	0.550	0.557	4.639E-17	176	0.749	0.761	Q32PV5.pdb.gz	TCF21_DANRE Transcription factor 21 OS=Danio rerio OX=7955 GN=tcf21 PE=2 SV=1
4	AFDB:O60682	0.539	0.473	6.486E-14	206	0.631	0.549	O60682.pdb.gz	MUSC_HUMAN Musculin OS=Homo sapiens OX=9606 GN=MSC PE=1 SV=2
5	AFDB:A0A2R8QBT6	0.554	0.615	7.414E-13	160	0.525	0.588	A0A2R8QBT6.pdb.gz	A0A2R8QBT6_DANRE Musculin OS=Danio rerio OX=7955 GN=msc PE=4 SV=1
6	AFDB:O88940	0.486	0.439	1.101E-12	201	0.592	0.527	O88940.pdb.gz	MUSC_MOUSE Musculin OS=Mus musculus OX=10090 GN=Msc PE=1 SV=1
7	AFDB:F1QWM8	0.480	0.268	1.192E-5	348	0.291	0.149	F1QWM8.pdb.gz	F1QWM8_DANRE Neurogenic differentiation factor OS=Danio rerio OX=7955 GN=ath3 PE=4 SV=1
8	AFDB:Q0IGT4	0.428	0.407	3.417E-5	189	0.257	0.243	Q0IGT4.pdb.gz	Q0IGT4_DROME Cousin of atonal OS=Drosophila melanogaster OX=7227 GN=cato PE=2 SV=1
9	AFDB:Q1LXV2	0.365	0.330	4.163E-5	199	0.274	0.246	Q1LXV2.pdb.gz
10	AFDB:Q7RTU0	0.356	0.380	4.447E-5	167	0.313	0.335	Q7RTU0.pdb.gz	TCF24_HUMAN Transcription factor 24 OS=Homo sapiens OX=9606 GN=TCF24 PE=1 SV=3
11	PDB:6zx9C	0.132	0.100	3.690	257	0.101	0.070	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
12	PDB:2q40A	0.163	0.092	4.210	343	0.045	0.023	2q40A.pdb.gz	Ensemble refinement of protein crystal structures: validation and application.
13	PDB:6rtpB	0.123	0.050	5.851	484	0.061	0.023	6rtpB.pdb.gz	A Hydrophilic Channel Is Involved in Oxidative Inactivation of a [NiFeSe] Hydrogenase
14	PDB:6hivAg	0.146	0.119	8.686	259	0.123	0.085	6hivAg.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:7qsmZ	0.158	0.192	8.686	142	0.101	0.127	7qsmZ.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
16	PDB:3ojaA	0.252	0.111	9.277	482	0.073	0.027	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
17	PDB:4v1nM	0.135	0.095	9.908	299	0.039	0.023	4v1nM.pdb.gz	Architecture of the RNA Polymerase II-Mediator Core Initiation Complex.
18	PDB:6kytC	0.100	0.230	9.908	73	0.050	0.123	6kytC.pdb.gz
19	PDB:6nj8B	0.116	0.077	9.908	277	0.039	0.025	6nj8B.pdb.gz	Large protein organelles form a new iron sequestration system with high storage capacity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43680	8.47e-133	370	179	1.000	1.000	TCF21_HUMAN Transcription factor 21 OS=Homo sapiens OX=9606 GN=TCF21 PE=1 SV=2
2	Q498R2	1.48e-128	360	179	0.972	0.972	Q498R2_RAT Transcription factor 21 OS=Rattus norvegicus OX=10116 GN=Tcf21 PE=4 SV=1
3	O35437	2.13e-127	357	179	0.961	0.961	TCF21_MOUSE Transcription factor 21 OS=Mus musculus OX=10090 GN=Tcf21 PE=2 SV=1
4	Q6GNB7	1.59e-114	324	179	0.860	0.860	TCF21_XENLA Transcription factor 21 OS=Xenopus laevis OX=8355 GN=tcf21 PE=2 SV=1
5	Q32PV5	4.75e-91	265	176	0.771	0.784	TCF21_DANRE Transcription factor 21 OS=Danio rerio OX=7955 GN=tcf21 PE=2 SV=1
6	O60682	1.94e-63	196	206	0.508	0.442	MUSC_HUMAN Musculin OS=Homo sapiens OX=9606 GN=MSC PE=1 SV=2
7	O88940	3.22e-60	187	201	0.486	0.433	MUSC_MOUSE Musculin OS=Mus musculus OX=10090 GN=Msc PE=1 SV=1
8	A0A2R8QBT6	6.91e-56	175	160	0.525	0.588	A0A2R8QBT6_DANRE Musculin OS=Danio rerio OX=7955 GN=msc PE=4 SV=1
9	Q0IGU7	3.15e-20	86.3	242	0.235	0.174	Q0IGU7_DROME HLH54F OS=Drosophila melanogaster OX=7227 GN=HLH54F PE=2 SV=1
10	O18374	3.21e-20	86.3	242	0.235	0.174	O18374_DROME BHLH protein OS=Drosophila melanogaster OX=7227 GN=HLH54F PE=2 SV=1
11	Q7RTU0	1.10e-16	75.5	167	0.240	0.257	TCF24_HUMAN Transcription factor 24 OS=Homo sapiens OX=9606 GN=TCF24 PE=1 SV=3
12	Q60756	4.62e-16	74.3	195	0.257	0.236	TCF15_MOUSE Transcription factor 15 OS=Mus musculus OX=10090 GN=Tcf15 PE=1 SV=2
13	Q7RTU1	1.32e-14	70.9	214	0.218	0.182	TCF23_HUMAN Transcription factor 23 OS=Homo sapiens OX=9606 GN=TCF23 PE=1 SV=1
14	P97831	1.96e-14	69.3	160	0.257	0.287	TWST2_RAT Twist-related protein 2 OS=Rattus norvegicus OX=10116 GN=Twist2 PE=2 SV=2
15	Q8WVJ9	1.96e-14	69.3	160	0.257	0.287	TWST2_HUMAN Twist-related protein 2 OS=Homo sapiens OX=9606 GN=TWIST2 PE=1 SV=1
16	Q9JLR5	5.34e-14	68.9	209	0.212	0.182	TCF23_MOUSE Transcription factor 23 OS=Mus musculus OX=10090 GN=Tcf23 PE=1 SV=1
17	Q9D030	7.59e-14	67.8	160	0.251	0.281	TWST2_MOUSE Twist-related protein 2 OS=Mus musculus OX=10090 GN=Twist2 PE=1 SV=1
18	Q12870	9.18e-14	68.2	199	0.184	0.166	TCF15_HUMAN Transcription factor 15 OS=Homo sapiens OX=9606 GN=TCF15 PE=2 SV=3
19	P59101	3.17e-13	66.6	187	0.179	0.171	SCX_CHICK Basic helix-loop-helix transcription factor scleraxis OS=Gallus gallus OX=9031 GN=SCX PE=2 SV=1
20	Q64124	3.72e-13	66.6	207	0.179	0.155	SCX_MOUSE Basic helix-loop-helix transcription factor scleraxis OS=Mus musculus OX=10090 GN=Scx PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	2.6e-12	57.8	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 185453.XP_006834714.1

Rank	PPI partner	STRING score	Description
1	185453.XP_006831673.1	0.853	Transcription factor 12 isoform X1
2	185453.XP_006837565.1	0.747	Transcription factor 4-like isoform X1
3	185453.XP_006869136.1	0.717	Transcription factor E2-alpha
4	185453.XP_006870709.1	0.713	T-box transcription factor TBX18
5	185453.XP_006864929.1	0.661	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins
6	185453.XP_006873869.1	0.657	Homeobox protein Nkx-3.2
7	185453.XP_006831667.1	0.610	Retinal dehydrogenase 2 isoform X1
8	185453.XP_006834705.1	0.605	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 7 Proteins
9	185453.XP_006834703.1	0.603	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 10 Proteins
10	185453.XP_006834715.1	0.567	Eyes absent homolog 4 isoform X1
11	185453.XP_006864864.1	0.564	Homeobox protein Nkx-2.5
12	185453.XP_006867353.1	0.562	Transcription factor GATA-6-like
13	185453.XP_006864387.1	0.549	Transcription factor GATA-4 isoform X1
14	185453.XP_006834400.1	0.545	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 15 Proteins
15	185453.XP_006832318.1	0.543	Myosin regulatory light chain 2, atrial isoform
16	185453.XP_006874969.1	0.541	Coronin-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043425	1.000	bHLH transcription factor binding
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.990	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.982	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0061629	0.868	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001228	0.854	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0019899	0.819	enzyme binding
GO:0050681	0.734	nuclear androgen receptor binding
GO:0070888	0.703	E-box binding
GO:0042826	0.683	histone deacetylase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0048856	0.995	anatomical structure development
GO:0050789	0.989	regulation of biological process
GO:0007275	0.984	multicellular organism development
GO:0050794	0.980	regulation of cellular process
GO:0019222	0.975	regulation of metabolic process
GO:0060255	0.937	regulation of macromolecule metabolic process
GO:0009889	0.928	regulation of biosynthetic process
GO:0048513	0.925	animal organ development
GO:0048731	0.908	system development
GO:0009987	0.900	cellular process
GO:0031323	0.892	regulation of cellular metabolic process
GO:0010468	0.890	regulation of gene expression
GO:0080090	0.888	regulation of primary metabolic process
GO:0051171	0.872	regulation of nitrogen compound metabolic process
GO:0019219	0.838	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.836	regulation of cellular biosynthetic process
GO:0006355	0.833	regulation of DNA-templated transcription
GO:0009888	0.696	tissue development
GO:0048518	0.694	positive regulation of biological process
GO:0048519	0.632	negative regulation of biological process
GO:0006357	0.591	regulation of transcription by RNA polymerase II
GO:0048523	0.569	negative regulation of cellular process
GO:0048522	0.544	positive regulation of cellular process
GO:0009890	0.510	negative regulation of biosynthetic process
GO:0051172	0.396	negative regulation of nitrogen compound metabolic process
GO:0045934	0.393	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.346	negative regulation of macromolecule metabolic process
GO:0050896	0.342	response to stimulus
GO:0051253	0.340	negative regulation of RNA metabolic process
GO:0010558	0.336	negative regulation of macromolecule biosynthetic process
GO:0009653	0.324	anatomical structure morphogenesis
GO:0031325	0.313	positive regulation of cellular metabolic process
GO:0045892	0.311	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.883	intracellular organelle lumen
GO:0032991	0.647	protein-containing complex
GO:0005737	0.318	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]