StarFunc result for job id O43683

User Input

>input (1085 residues)
MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKK
KYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASA
VLQRGIQNQAEPREFLQQQYRLFQTRLTETHLPAQARTSEPLHNVQVLNQMITSKSNPGN
NMACISKNQGSELSGVISSACDKESNMERRVITISKSEYSVHSSLASKVDVEQVVMYCKE
KLIRGESEFSFEELRAQKYNQRRKHEQWVNEDRHYMKRKEANAFEEQLLKQKMDELHKKL
HQVVETSHEDLPASQERSEVNPARMGPSVGSQQELRAPCLPVTYQQTPVNMEKNPREAPP
VVPPLANAISAALVSPATSQSIAPPVPLKAQTVTDSMFAVASKDAGCVNKSTHEFKPQSG
AEIKEGCETHKVANTSSFHTTPNTSLGMVQATPSKVQPSPTVHTKEALGFIMNMFQAPTL
PDISDDKDEWQSLDQNEDAFEAQFQKNVRSSGAWGVNKIISSLSSAFHVFEDGNKENYGL
PQPKNKPTGARTFGERSVSRLPSKPKEEVPHAEEFLDDSTVWGIRCNKTLAPSPKSPGDF
TSAAQLASTPFHKLPVESVHILEDKENVVAKQCTQATLDSCEENMVVPSRDGKFSPIQEK
SPKQALSSHMYSASLLRLSQPAAGGVLTCEAELGVEACRLTDTDAAIAEDPPDAIAGLQA
EWMQMSSLGTVDAPNFIVGNPWDDKLIFKLLSGLSKPVSSYPNTFEWQCKLPAIKPKTEF
QLGSKLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMER
LKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMR
MLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGT
IFTAKCETSGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFR
RLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLEC
KRSRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A5D3	0.464	0.474	0.000	1059	0.717	0.735	D4A5D3.pdb.gz	D4A5D3_RAT BUB1 mitotic checkpoint serine/threonine kinase OS=Rattus norvegicus OX=10116 GN=Bub1 PE=4 SV=1
2	AFDB:O43683	1.000	1.000	0.000	1085	1.000	1.000	O43683.pdb.gz	BUB1_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Homo sapiens OX=9606 GN=BUB1 PE=1 SV=1
3	PDB:6qx9K	0.204	0.635	3.316E-11	322	0.051	0.171	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
4	PDB:6pjxA	0.198	0.374	1.051E-10	543	0.042	0.085	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
5	PDB:2yaaA	0.181	0.591	1.570E-10	300	0.051	0.183	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
6	PDB:3c4wB	0.194	0.382	1.651E-10	519	0.051	0.106	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
7	PDB:3nynA	0.198	0.364	2.466E-10	554	0.045	0.088	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
8	AFDB:G5EB22	0.165	0.171	3.577E-10	1050	0.107	0.110	G5EB22.pdb.gz	G5EB22_EMENI Protein kinase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05822 PE=4 SV=1
9	AFDB:P0CY24	0.190	0.170	3.577E-10	1228	0.150	0.133	P0CY24.pdb.gz	STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CST20 PE=3 SV=1
10	PDB:4mk0A	0.178	0.289	5.503E-10	631	0.045	0.078	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
11	AFDB:P07527	0.185	0.224	7.219E-10	877	0.116	0.144	P07527.pdb.gz	WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wee1 PE=1 SV=1
12	PDB:4rerA	0.192	0.426	8.220E-10	459	0.045	0.107	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
13	AFDB:E1JGN0	0.207	0.197	8.391E-10	1141	0.104	0.099	E1JGN0.pdb.gz	E1JGN0_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
14	PDB:2bujA	0.186	0.628	8.643E-10	291	0.043	0.162	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
15	PDB:4yhjA	0.198	0.404	9.088E-10	501	0.042	0.092	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
16	PDB:3uzsA	0.186	0.315	9.555E-10	609	0.045	0.080	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
17	AFDB:Q9VP22	0.167	0.158	2.187E-8	1157	0.148	0.139	Q9VP22.pdb.gz	CDK12_DROME Cyclin-dependent kinase 12 OS=Drosophila melanogaster OX=7227 GN=Cdk12 PE=1 SV=1
18	AFDB:Q24315	0.200	0.178	2.555E-7	1235	0.133	0.117	Q24315.pdb.gz	Q24315_DROME Tyrosine kinase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Tie PE=2 SV=1
19	AFDB:A0A024RDM3	0.167	0.166	5.158E-7	1088	0.122	0.121	A0A024RDM3.pdb.gz
20	AFDB:Q8IDK6	0.204	0.128	1.728E-5	1807	0.119	0.071	Q8IDK6.pdb.gz	Q8IDK6_PLAF7 Tyrosine kinase-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1349300 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GIT9	0.0	1320	965	0.619	0.696	A0A8I6GIT9_RAT BUB1 mitotic checkpoint serine/threonine kinase OS=Rattus norvegicus OX=10116 GN=Bub1 PE=4 SV=1
2	D4A5D3	0.0	1561	1059	0.721	0.738	D4A5D3_RAT BUB1 mitotic checkpoint serine/threonine kinase OS=Rattus norvegicus OX=10116 GN=Bub1 PE=4 SV=1
3	O08901	0.0	1584	1058	0.724	0.742	BUB1_MOUSE Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Mus musculus OX=10090 GN=Bub1 PE=1 SV=1
4	O43683	0.0	2274	1085	1.000	1.000	BUB1_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Homo sapiens OX=9606 GN=BUB1 PE=1 SV=1
5	Q7KN56	5.18e-44	177	1484	0.099	0.072	Q7KN56_DROME LD23835p (Fragment) OS=Drosophila melanogaster OX=7227 GN=BubR1 PE=2 SV=1
6	A1Z6I7	5.41e-44	176	1460	0.099	0.073	A1Z6I7_DROME Bub1-related kinase OS=Drosophila melanogaster OX=7227 GN=BubR1 PE=1 SV=1
7	O76755	8.05e-44	176	1461	0.099	0.073	O76755_DROME Mitotic checkpoint control protein kinase BUB1 OS=Drosophila melanogaster OX=7227 GN=BubR1 PE=2 SV=1
8	P41695	1.61e-43	174	1021	0.106	0.113	BUB1_YEAST Checkpoint serine/threonine-protein kinase BUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUB1 PE=1 SV=2
9	Q9VMS5	1.05e-41	169	1099	0.087	0.086	Q9VMS5_DROME Bub1 kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Bub1 PE=2 SV=1
10	Q21776	2.71e-39	160	987	0.101	0.111	BUB1_CAEEL Mitotic checkpoint serine/threonine-protein kinase bub-1 OS=Caenorhabditis elegans OX=6239 GN=bub-1 PE=1 SV=1
11	O94751	1.11e-34	146	1044	0.088	0.091	BUB1_SCHPO Checkpoint serine/threonine-protein kinase bub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bub1 PE=1 SV=1
12	O60566	1.88e-26	119	1050	0.053	0.054	BUB1B_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens OX=9606 GN=BUB1B PE=1 SV=3
13	Q9Z1S0	6.99e-23	108	1052	0.044	0.046	BUB1B_MOUSE Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Mus musculus OX=10090 GN=Bub1b PE=1 SV=2
14	O59767	8.56e-19	90.9	310	0.053	0.187	MAD3_SCHPO Mitotic spindle checkpoint component mad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mad3 PE=1 SV=2
15	O22806	1.87e-17	88.2	395	0.049	0.134	BUBR1_ARATH Mitotic spindle checkpoint protein BUBR1 OS=Arabidopsis thaliana OX=3702 GN=BUBR1 PE=1 SV=2
16	Q9FFG4	3.32e-14	79.0	471	0.043	0.100	Q9FFG4_ARATH At5g05510 OS=Arabidopsis thaliana OX=3702 GN=MOP10.5 PE=1 SV=1
17	O88866	5.69e-09	62.8	714	0.051	0.077	HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus OX=10090 GN=Hunk PE=2 SV=1
18	P57058	8.95e-09	62.0	714	0.051	0.077	HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens OX=9606 GN=HUNK PE=1 SV=1
19	P47074	1.98e-08	60.5	515	0.034	0.072	MAD3_YEAST Spindle assembly checkpoint component MAD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAD3 PE=1 SV=1
20	Q9Y7J6	6.74e-08	58.9	551	0.065	0.129	PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk21 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10468 Inhibitor_I68	1.3e+02	14.4	Carboxypeptidase inhibitor I68
2	PF08311 Mad3_BUB1_I	1.8e-32	123.3	Mad3/BUB1 homology region 1
3	PF17014 Mad3_BUB1_I_2	0.0048	28.5	Putative Mad3/BUB1 like region 1 protein
4	PF00069 Pkinase	7.6e-13	60.0	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	0.014	26.2	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302530

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261597	0.999	Kinetochore protein NDC80 homolog
2	9606.ENSP00000296509	0.999	Mitotic spindle assembly checkpoint protein MAD2A
3	9606.ENSP00000300093	0.999	Serine/threonine-protein kinase PLK1
4	9606.ENSP00000313950	0.999	Aurora kinase B
5	9606.ENSP00000335463	0.999	Kinetochore scaffold 1
6	9606.ENSP00000357858	0.999	Mitotic checkpoint protein BUB3
7	9606.ENSP00000358813	0.999	Dual specificity protein kinase TTK
8	9606.ENSP00000361540	0.999	Cell division cycle protein 20 homolog
9	9606.ENSP00000378699	0.999	Cyclin-dependent kinase 1
10	9606.ENSP00000256442	0.998	G2/mitotic-specific cyclin-B1
11	9606.ENSP00000287598	0.998	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
12	9606.ENSP00000355922	0.998	Centromere protein F
13	9606.ENSP00000362146	0.998	Borealin
14	9606.ENSP00000260731	0.997	Kinesin-like protein KIF11
15	9606.ENSP00000265148	0.996	Centromere-associated protein E
16	9606.ENSP00000301633	0.996	Baculoviral IAP repeat containing 5
17	9606.ENSP00000288207	0.995	G2/mitotic-specific cyclin-B2
18	9606.ENSP00000378295	0.995	Inner centromere protein
19	9606.ENSP00000271452	0.994	Kinetochore protein Nuf2
20	9606.ENSP00000216911	0.993	Aurora kinase A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.978	regulation of cellular process
GO:0051716	0.943	cellular response to stimulus
GO:0035556	0.919	intracellular signal transduction
GO:0007049	0.916	cell cycle
GO:0022402	0.914	cell cycle process
GO:1901990	0.900	regulation of mitotic cell cycle phase transition
GO:0045786	0.889	negative regulation of cell cycle
GO:0000075	0.880	cell cycle checkpoint signaling
GO:0007088	0.874	regulation of mitotic nuclear division
GO:0007093	0.871	mitotic cell cycle checkpoint signaling
GO:1902099	0.865	regulation of metaphase/anaphase transition of cell cycle
GO:0030071	0.864	regulation of mitotic metaphase/anaphase transition
GO:1901991	0.854	negative regulation of mitotic cell cycle phase transition
GO:0010639	0.846	negative regulation of organelle organization
GO:0033047	0.845	regulation of mitotic sister chromatid segregation
GO:0010965	0.837	regulation of mitotic sister chromatid separation
GO:0045841	0.830	negative regulation of mitotic metaphase/anaphase transition
GO:0007094	0.803	mitotic spindle assembly checkpoint signaling
GO:0048518	0.358	positive regulation of biological process
GO:0048522	0.333	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000776	0.999	kinetochore
GO:0005654	0.995	nucleoplasm
GO:0005829	0.989	cytosol
GO:0016020	0.978	membrane
GO:0032991	0.901	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]