StarFunc result for job id O43684

User Input

>input (328 residues)
MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVL
DCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTV
KLWDPRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKY
QTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAI
SFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYE
MDDTEHPEDGIFIRQVTDAETKPKSPCT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9YGY3	0.987	0.981	1.419E-62	330	0.921	0.915	Q9YGY3.pdb.gz	BUB3_XENLA Mitotic checkpoint protein BUB3 OS=Xenopus laevis OX=8355 GN=bub3 PE=1 SV=1
2	AFDB:Q9LJN8	0.976	0.942	9.428E-47	340	0.534	0.515	Q9LJN8.pdb.gz	BUB31_ARATH Mitotic checkpoint protein BUB3.1 OS=Arabidopsis thaliana OX=3702 GN=BUB3.1 PE=1 SV=1
3	AFDB:O76523	0.955	0.958	8.565E-44	327	0.543	0.544	O76523.pdb.gz	O76523_DROME Mitotic checkpoint control protein OS=Drosophila melanogaster OX=7227 GN=Bub3 PE=2 SV=1
4	AFDB:Q9XWH0	0.964	0.922	1.634E-39	343	0.427	0.408	Q9XWH0.pdb.gz	BUB3_CAEEL Mitotic checkpoint protein bub-3 OS=Caenorhabditis elegans OX=6239 GN=bub-3 PE=1 SV=1
5	AFDB:C8VP05	0.942	0.867	3.324E-37	357	0.399	0.367	C8VP05.pdb.gz	C8VP05_EMENI Spindle assembly checkpoint protein SLDB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02439 PE=4 SV=1
6	AFDB:G5EAY9	0.940	0.854	1.646E-36	362	0.381	0.345	G5EAY9.pdb.gz	G5EAY9_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01379 PE=4 SV=1
7	AFDB:Q8MSW6	0.868	0.881	9.515E-36	323	0.476	0.483	Q8MSW6.pdb.gz	Q8MSW6_DROME LD23540p OS=Drosophila melanogaster OX=7227 GN=Bub3 PE=2 SV=1
8	AFDB:O42860	0.921	0.943	5.792E-35	320	0.338	0.347	O42860.pdb.gz	BUB3_SCHPO Mitotic checkpoint protein bub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bub3 PE=1 SV=1
9	AFDB:P41838	0.939	0.877	2.587E-34	352	0.351	0.327	P41838.pdb.gz	RAE1_SCHPO Poly(A)+ RNA export protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rae1 PE=1 SV=1
10	AFDB:Q38942	0.920	0.866	1.042E-33	349	0.390	0.367	Q38942.pdb.gz	RAE1_ARATH Protein RAE1 OS=Arabidopsis thaliana OX=3702 GN=RAE1 PE=1 SV=2
11	PDB:3mmyC	0.904	0.838	1.385E-29	355	0.348	0.321	3mmyC.pdb.gz
12	PDB:1yfqA	0.810	0.779	1.588E-22	342	0.293	0.281	1yfqA.pdb.gz	The 1.1-a structure of the spindle checkpoint protein bub3p reveals functional regions.
13	PDB:2h9lA	0.763	0.778	8.178E-20	321	0.174	0.178	2h9lA.pdb.gz
14	PDB:5nnzA	0.685	0.673	2.111E-18	335	0.177	0.173	5nnzA.pdb.gz
15	PDB:5mzhB	0.667	0.539	1.844E-17	415	0.162	0.128	5mzhB.pdb.gz
16	PDB:7jvrB	0.783	0.753	3.799E-17	342	0.189	0.181	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
17	PDB:3jcmB	0.771	0.598	1.066E-16	429	0.171	0.131	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
18	PDB:7mq8SG	0.825	0.703	1.245E-16	389	0.174	0.147	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7mq8LS	0.750	0.557	1.530E-16	453	0.159	0.115	7mq8LS.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:5mqfF	0.746	0.794	1.696E-16	307	0.195	0.208	5mqfF.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJF3	0.0	687	326	0.991	0.997	A0A140VJF3_HUMAN Testicular tissue protein Li 27 OS=Homo sapiens OX=9606 PE=2 SV=1
2	O43684	0.0	694	328	1.000	1.000	BUB3_HUMAN Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3 PE=1 SV=1
3	Q9WVA3	0.0	687	326	0.991	0.997	BUB3_MOUSE Mitotic checkpoint protein BUB3 OS=Mus musculus OX=10090 GN=Bub3 PE=1 SV=2
4	Q9YGY3	0.0	650	330	0.921	0.915	BUB3_XENLA Mitotic checkpoint protein BUB3 OS=Xenopus laevis OX=8355 GN=bub3 PE=1 SV=1
5	Q9VAJ2	1.58e-144	412	326	0.595	0.598	Q9VAJ2_DROME Bub3, isoform A OS=Drosophila melanogaster OX=7227 GN=Bub3 PE=1 SV=1
6	Q9XYF7	1.96e-142	407	326	0.585	0.589	Q9XYF7_DROME WD-40 repeat protein OS=Drosophila melanogaster OX=7227 GN=Bub3 PE=2 SV=1
7	O76523	4.05e-128	370	327	0.558	0.560	O76523_DROME Mitotic checkpoint control protein OS=Drosophila melanogaster OX=7227 GN=Bub3 PE=2 SV=1
8	Q9LJN8	4.70e-128	371	340	0.543	0.524	BUB31_ARATH Mitotic checkpoint protein BUB3.1 OS=Arabidopsis thaliana OX=3702 GN=BUB3.1 PE=1 SV=1
9	Q8MSW6	9.84e-110	324	323	0.457	0.464	Q8MSW6_DROME LD23540p OS=Drosophila melanogaster OX=7227 GN=Bub3 PE=2 SV=1
10	Q9XWH0	5.13e-93	282	343	0.439	0.420	BUB3_CAEEL Mitotic checkpoint protein bub-3 OS=Caenorhabditis elegans OX=6239 GN=bub-3 PE=1 SV=1
11	C8VP05	9.69e-86	264	357	0.424	0.389	C8VP05_EMENI Spindle assembly checkpoint protein SLDB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02439 PE=4 SV=1
12	Q38942	1.49e-67	217	349	0.390	0.367	RAE1_ARATH Protein RAE1 OS=Arabidopsis thaliana OX=3702 GN=RAE1 PE=1 SV=2
13	Q54QH0	3.08e-66	213	342	0.393	0.377	Q54QH0_DICDI WD40 repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=rae1 PE=4 SV=1
14	O42860	1.07e-63	206	320	0.338	0.347	BUB3_SCHPO Mitotic checkpoint protein bub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bub3 PE=1 SV=1
15	G5EAY9	1.82e-63	207	362	0.372	0.337	G5EAY9_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01379 PE=4 SV=1
16	P40066	4.07e-62	203	365	0.357	0.321	GLE2_YEAST mRNA export factor GLE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLE2 PE=1 SV=1
17	Q9W2E7	3.00e-60	198	346	0.375	0.355	RAE1_DROME Protein Rae1 OS=Drosophila melanogaster OX=7227 GN=Rae1 PE=1 SV=1
18	P41838	3.49e-60	198	352	0.351	0.327	RAE1_SCHPO Poly(A)+ RNA export protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rae1 PE=1 SV=1
19	Q7ZZY7	4.18e-60	198	368	0.369	0.329	Q7ZZY7_XENLA Rae1/Gle2 OS=Xenopus laevis OX=8355 GN=rae1.S PE=1 SV=1
20	Q8C570	8.27e-59	195	368	0.360	0.321	RAE1L_MOUSE mRNA export factor OS=Mus musculus OX=10090 GN=Rae1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.08	24.6	Anaphase-promoting complex subunit 4 WD40 domain
2	PF20426 NBCH_WD40	29	14.9	Neurobeachin beta propeller domain
3	PF00400 WD40	7.8e-19	78.9	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008577754.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008571945.1	0.998	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
2	482537.XP_008580496.1	0.998	Cell division cycle protein 20 homolog
3	482537.XP_008580627.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 9 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
4	482537.XP_008569321.1	0.990	BUB3-interacting and GLEBS motif-containing protein ZNF207 isoform X1
5	482537.XP_008571017.1	0.990	Cell division cycle protein 23 homolog isoform X1
6	482537.XP_008590186.1	0.988	Mitotic checkpoint serine/threonine-protein kinase BUB1
7	482537.XP_008592288.1	0.988	Mitotic checkpoint serine/threonine-protein kinase BUB1-like
8	482537.XP_008564848.1	0.985	Cyclin-dependent kinase 1
9	482537.XP_008575429.1	0.985	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
10	482537.XP_008561922.1	0.973	Cell division cycle protein 27 homolog
11	482537.XP_008580874.1	0.968	Cell division cycle protein 16 homolog isoform X1
12	482537.XP_008568685.1	0.966	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 8 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
13	482537.XP_008573351.1	0.957	Anaphase-promoting complex subunit 1 isoform X1
14	482537.XP_008581113.1	0.953	Fizzy-related protein homolog
15	482537.XP_008567384.1	0.947	Kinetochore protein NDC80 homolog
16	482537.XP_008574519.1	0.944	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
17	482537.XP_008576155.1	0.941	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
18	482537.XP_008587799.1	0.941	Centromere/kinetochore protein zw10 homolog isoform X1
19	482537.XP_008566970.1	0.934	Anaphase-promoting complex subunit CDC26
20	482537.XP_008564971.1	0.928	Mitotic spindle assembly checkpoint protein MAD1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010564	0.990	regulation of cell cycle process
GO:0007049	0.989	cell cycle
GO:0048519	0.974	negative regulation of biological process
GO:0051983	0.955	regulation of chromosome segregation
GO:0022402	0.943	cell cycle process
GO:0019222	0.831	regulation of metabolic process
GO:0051179	0.812	localization
GO:0098813	0.812	nuclear chromosome segregation
GO:1903320	0.803	regulation of protein modification by small protein conjugation or removal
GO:0051641	0.794	cellular localization
GO:0071459	0.761	protein localization to chromosome, centromeric region
GO:0008608	0.748	attachment of spindle microtubules to kinetochore
GO:0048523	0.706	negative regulation of cellular process
GO:1903083	0.700	protein localization to condensed chromosome
GO:0051172	0.667	negative regulation of nitrogen compound metabolic process
GO:0010605	0.652	negative regulation of macromolecule metabolic process
GO:0071704	0.572	organic substance metabolic process
GO:0000278	0.504	mitotic cell cycle
GO:0043170	0.502	macromolecule metabolic process
GO:0050896	0.460	response to stimulus
GO:0048518	0.455	positive regulation of biological process
GO:0071840	0.410	cellular component organization or biogenesis
GO:0031323	0.389	regulation of cellular metabolic process
GO:0016043	0.379	cellular component organization
GO:0044238	0.362	primary metabolic process
GO:1903047	0.354	mitotic cell cycle process
GO:0006807	0.340	nitrogen compound metabolic process
GO:0051716	0.307	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0032991	0.996	protein-containing complex
GO:0098687	0.990	chromosomal region
GO:0099080	0.987	supramolecular complex
GO:0000775	0.970	chromosome, centromeric region
GO:0000793	0.969	condensed chromosome
GO:0000779	0.927	condensed chromosome, centromeric region
GO:0000776	0.922	kinetochore
GO:0140513	0.881	nuclear protein-containing complex
GO:0015630	0.645	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]