StarFunc result for job id O43707

User Input

>input (911 residues)
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWC
NSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIA
SKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPY
KNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM
LDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEK
LASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTL
QTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ
KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQEL
NELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPF
NNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAES
NHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANV
VGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIF
DNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKD
HGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETT
DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKS
FSTALYGESDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P57780	0.872	0.871	3.483E-104	912	0.985	0.984	P57780.pdb.gz	ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus OX=10090 GN=Actn4 PE=1 SV=1
2	AFDB:P05094	0.866	0.882	9.008E-98	893	0.842	0.859	P05094.pdb.gz	ACTN1_CHICK Alpha-actinin-1 OS=Gallus gallus OX=9031 GN=ACTN1 PE=1 SV=3
3	AFDB:A0A2R8QBL5	0.920	0.936	4.096E-90	895	0.749	0.762	A0A2R8QBL5.pdb.gz
4	AFDB:P20111	0.932	0.946	2.025E-88	897	0.761	0.773	P20111.pdb.gz	ACTN2_CHICK Alpha-actinin-2 OS=Gallus gallus OX=9031 GN=ACTN2 PE=2 SV=1
5	AFDB:L7UZ85	0.853	0.877	6.886E-83	885	0.675	0.695	L7UZ85.pdb.gz	ACTN_DERFA Alpha-actinin OS=Dermatophagoides farinae OX=6954 PE=1 SV=1
6	AFDB:B2R8Y4	0.484	0.489	1.310E-81	901	0.729	0.737	B2R8Y4.pdb.gz	B2R8Y4_HUMAN cDNA, FLJ94117, highly similar to Homo sapiens actinin, alpha 3 (ACTN3), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
7	AFDB:P18091	0.392	0.389	5.191E-77	924	0.679	0.670	P18091.pdb.gz	ACTN_DROME Alpha-actinin, sarcomeric OS=Drosophila melanogaster OX=7227 GN=Actn PE=1 SV=2
8	AFDB:Q23158	0.651	0.645	8.867E-74	920	0.609	0.603	Q23158.pdb.gz	Q23158_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
9	AFDB:Q9XVU8	0.534	0.543	3.614E-71	894	0.613	0.624	Q9XVU8.pdb.gz	Q9XVU8_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
10	PDB:4d1eA	0.402	0.426	6.497E-65	859	0.734	0.779	4d1eA.pdb.gz
11	PDB:1sjjA	0.237	0.249	9.674E-65	863	0.811	0.856	1sjjA.pdb.gz
12	AFDB:P05095	0.433	0.453	2.501E-46	861	0.359	0.380	P05095.pdb.gz	ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum OX=44689 GN=abpA PE=1 SV=2
13	PDB:7sx8D	0.197	0.367	3.304E-5	448	0.061	0.125	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
14	PDB:1a2xA	0.086	0.420	1.236E-3	158	0.038	0.222	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
15	PDB:3qrxA	0.087	0.436	2.158E-3	145	0.037	0.234	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
16	PDB:1ggzA	0.110	0.421	2.246E-3	144	0.050	0.319	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
17	PDB:5d43A	0.092	0.420	2.246E-3	150	0.036	0.220	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
18	PDB:6hr1A	0.076	0.159	3.344E-3	406	0.046	0.103	6hr1A.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
19	PDB:6xyrA	0.075	0.181	4.245E-3	348	0.058	0.152	6xyrA.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
20	PDB:1osaA	0.098	0.385	4.597E-3	148	0.046	0.284	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3G9	1900	911	1.000	1.000	A0A0S2Z3G9_HUMAN Actinin alpha 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ACTN4 PE=2 SV=1
2	A0A8I5ZN92	1462	898	0.761	0.772	A0A8I5ZN92_RAT Actinin alpha 2 OS=Rattus norvegicus OX=10116 GN=Actn2 PE=1 SV=1
3	A0A8I6ARF4	1301	816	0.670	0.748	A0A8I6ARF4_RAT Actinin alpha 2 OS=Rattus norvegicus OX=10116 GN=Actn2 PE=1 SV=1
4	B2R8Y4	1418	901	0.718	0.726	B2R8Y4_HUMAN cDNA, FLJ94117, highly similar to Homo sapiens actinin, alpha 3 (ACTN3), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
5	D3ZCV0	1454	876	0.753	0.783	D3ZCV0_RAT Actinin alpha 2 OS=Rattus norvegicus OX=10116 GN=Actn2 PE=1 SV=2
6	F5GXS2	1892	911	0.997	0.997	F5GXS2_HUMAN Actinin alpha 4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=3
7	H2L2C8	1058	823	0.555	0.615	H2L2C8_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
8	H2L2C9	1035	849	0.552	0.592	H2L2C9_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
9	H7C144	1850	906	0.976	0.981	H7C144_HUMAN Actinin alpha 4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2
10	L7UZ85	1301	885	0.674	0.694	ACTN_DERFA Alpha-actinin OS=Dermatophagoides farinae OX=6954 PE=1 SV=1
11	O43707	1900	911	1.000	1.000	ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2
12	O88990	1424	900	0.723	0.732	ACTN3_MOUSE Alpha-actinin-3 OS=Mus musculus OX=10090 GN=Actn3 PE=2 SV=1
13	P05094	1621	893	0.840	0.857	ACTN1_CHICK Alpha-actinin-1 OS=Gallus gallus OX=9031 GN=ACTN1 PE=1 SV=3
14	P05095	589	861	0.367	0.388	ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum OX=44689 GN=abpA PE=1 SV=2
15	P12814	1620	892	0.840	0.858	ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2
16	P18091	1287	924	0.679	0.670	ACTN_DROME Alpha-actinin, sarcomeric OS=Drosophila melanogaster OX=7227 GN=Actn PE=1 SV=2
17	P20111	1481	897	0.761	0.773	ACTN2_CHICK Alpha-actinin-2 OS=Gallus gallus OX=9031 GN=ACTN2 PE=2 SV=1
18	P35609	1468	894	0.755	0.770	ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens OX=9606 GN=ACTN2 PE=1 SV=1
19	P57780	1873	912	0.986	0.985	ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus OX=10090 GN=Actn4 PE=1 SV=1
20	Q08043	1413	901	0.716	0.724	ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens OX=9606 GN=ACTN3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	0.0023	29.0	CAMSAP CH domain
2	PF00307 CH	2.3e-50	180.7	Calponin homology (CH) domain
3	PF00036 EF-hand_1	1.6e-06	38.3	EF hand
4	PF13202 EF-hand_5	4.2e+02	11.9	EF hand
5	PF13405 EF-hand_6	0.00075	30.2	EF-hand domain
6	PF13499 EF-hand_7	0.0046	28.7	EF-hand domain pair
7	PF13833 EF-hand_8	4	18.6	EF-hand domain pair
8	PF08726 EFhand_Ca_insen	2.8e-23	93.2	Ca2+ insensitive EF hand
9	PF19191 HEF_HK	51	15.8	HEF_HK domain
10	PF00435 Spectrin	2.3e-67	235.5	Spectrin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010384031.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010358026.1	0.994	Alpha-actinin-1
2	61622.XP_010378790.1	0.963	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 236 ESTs, 2 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments
3	61622.XP_010377704.1	0.961	Zyxin
4	61622.XP_010371436.1	0.946	Vinculin
5	61622.XP_010386408.1	0.941	Catenin alpha 1
6	61622.XP_010364949.1	0.935	MICAL-like protein 2
7	61622.XP_010352583.1	0.928	Actin gamma 1
8	61622.XP_010365296.1	0.922	Actin, cytoplasmic 1
9	61622.XP_010364546.1	0.920	PDZ and LIM domain protein 1
10	61622.XP_010382980.1	0.920	Alpha-actinin-2
11	61622.XP_010381829.1	0.916	Tripartite motif containing 3
12	61622.XP_010362739.1	0.914	Belongs to the integrin beta chain family.
13	61622.XP_010359169.1	0.909	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 191 ESTs, 2 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
14	61622.XP_010358011.1	0.907	Catenin alpha-3
15	61622.XP_010380844.1	0.898	SSX family member 2 interacting protein
16	61622.XP_010384360.1	0.892	Belongs to the integrin alpha chain family.
17	61622.XP_010356596.1	0.883	LIM domain only protein 7 isoform X1
18	61622.XP_010364712.1	0.878	Alpha-actinin-3
19	61622.XP_010359804.1	0.877	Belongs to the tropomyosin family.
20	61622.XP_010361826.1	0.863	Belongs to the integrin beta chain family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.997	cytoskeletal protein binding
GO:0044877	0.992	protein-containing complex binding
GO:0003779	0.918	actin binding
GO:0042802	0.749	identical protein binding
GO:0051015	0.648	actin filament binding
GO:0005198	0.620	structural molecule activity
GO:0050839	0.549	cell adhesion molecule binding
GO:0005200	0.520	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0065007	0.983	biological regulation
GO:0050794	0.951	regulation of cellular process
GO:0048856	0.932	anatomical structure development
GO:0050896	0.909	response to stimulus
GO:0016043	0.907	cellular component organization
GO:0044085	0.849	cellular component biogenesis
GO:0022607	0.844	cellular component assembly
GO:0006996	0.824	organelle organization
GO:0030029	0.801	actin filament-based process
GO:0030036	0.772	actin cytoskeleton organization
GO:0051179	0.717	localization
GO:0097435	0.643	supramolecular fiber organization
GO:0048518	0.556	positive regulation of biological process
GO:0032501	0.549	multicellular organismal process
GO:0048522	0.512	positive regulation of cellular process
GO:0034330	0.511	cell junction organization
GO:0051716	0.472	cellular response to stimulus
GO:0048519	0.455	negative regulation of biological process
GO:0048523	0.446	negative regulation of cellular process
GO:0051641	0.412	cellular localization
GO:0030154	0.393	cell differentiation
GO:0019222	0.385	regulation of metabolic process
GO:0048583	0.365	regulation of response to stimulus
GO:0007275	0.360	multicellular organism development
GO:0007154	0.354	cell communication
GO:0031323	0.305	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0015629	0.998	actin cytoskeleton
GO:0071944	0.996	cell periphery
GO:0032991	0.994	protein-containing complex
GO:0012505	0.991	endomembrane system
GO:0005886	0.991	plasma membrane
GO:0005634	0.986	nucleus
GO:0005576	0.981	extracellular region
GO:0120025	0.980	plasma membrane bounded cell projection
GO:0005654	0.980	nucleoplasm
GO:0030055	0.974	cell-substrate junction
GO:0005925	0.963	focal adhesion
GO:0031982	0.958	vesicle
GO:0005615	0.950	extracellular space
GO:0043230	0.916	extracellular organelle
GO:0070062	0.911	extracellular exosome
GO:0032432	0.844	actin filament bundle
GO:0099080	0.832	supramolecular complex
GO:0016604	0.793	nuclear body
GO:0031410	0.779	cytoplasmic vesicle
GO:0097517	0.768	contractile actin filament bundle
GO:0001725	0.762	stress fiber
GO:0043292	0.727	contractile fiber
GO:0031143	0.703	pseudopodium
GO:0030016	0.413	myofibril
GO:0005938	0.375	cell cortex
GO:0030017	0.371	sarcomere
GO:0030863	0.340	cortical cytoskeleton
GO:0031674	0.320	I band
GO:0031252	0.305	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]