StarFunc result for job id O43708

User Input

>input (216 residues)
MQAGKPILYSYFRSSCSWRVRIALALKGIDYKTVPINLIKDRGQQFSKDFQALNPMKQVP
TLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLK
QVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDL
TPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43708	1.000	1.000	2.699E-36	216	1.000	1.000	O43708.pdb.gz	MAAI_HUMAN Maleylacetoacetate isomerase OS=Homo sapiens OX=9606 GN=GSTZ1 PE=1 SV=3
2	AFDB:Q9WVL0	0.996	0.996	1.659E-32	216	0.843	0.843	Q9WVL0.pdb.gz	MAAI_MOUSE Maleylacetoacetate isomerase OS=Mus musculus OX=10090 GN=Gstz1 PE=1 SV=1
3	PDB:1fw1A	0.960	0.997	1.770E-31	208	0.954	0.990	1fw1A.pdb.gz	Crystal structure of maleylacetoacetate isomerase/glutathione transferase zeta reveals the molecular basis for its remarkable catalytic promiscuity.
4	PDB:2cz2A	0.980	0.998	9.171E-31	212	0.829	0.844	2cz2A.pdb.gz	Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from Mus musculus (form-1 crystal)
5	AFDB:Q6DGL3	0.972	0.954	8.693E-28	220	0.644	0.632	Q6DGL3.pdb.gz	Q6DGL3_DANRE maleylacetoacetate isomerase OS=Danio rerio OX=7955 GN=zgc:92869 PE=1 SV=1
6	AFDB:Q9VHD2	0.971	0.924	2.220E-26	227	0.574	0.546	Q9VHD2.pdb.gz	MAAI2_DROME Probable maleylacetoacetate isomerase 2 OS=Drosophila melanogaster OX=7227 GN=GstZ2 PE=1 SV=1
7	AFDB:Q9VHD3	0.967	0.850	4.689E-26	246	0.565	0.496	Q9VHD3.pdb.gz	MAAI1_DROME Probable maleylacetoacetate isomerase 1 OS=Drosophila melanogaster OX=7227 GN=GstZ1 PE=1 SV=1
8	PDB:2cz3A	0.876	0.990	5.005E-25	191	0.755	0.853	2cz3A.pdb.gz
9	AFDB:Q18938	0.934	0.942	2.225E-21	214	0.477	0.481	Q18938.pdb.gz	MAAI_CAEEL Probable maleylacetoacetate isomerase OS=Caenorhabditis elegans OX=6239 GN=gst-42 PE=1 SV=1
10	AFDB:Q9ZVQ3	0.937	0.916	4.470E-21	221	0.458	0.448	Q9ZVQ3.pdb.gz	GSTZ1_ARATH Glutathione S-transferase Z1 OS=Arabidopsis thaliana OX=3702 GN=GSTZ1 PE=1 SV=1
11	AFDB:Q9ZVQ4	0.938	0.910	2.690E-20	223	0.449	0.435	Q9ZVQ4.pdb.gz	GSTZ2_ARATH Glutathione S-transferase Z2 OS=Arabidopsis thaliana OX=3702 GN=GSTZ2 PE=3 SV=1
12	AFDB:O43123	0.933	0.877	2.294E-19	230	0.472	0.443	O43123.pdb.gz	MAAI_EMENI Maleylacetoacetate isomerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=maiA PE=1 SV=1
13	PDB:2v6kA	0.921	0.929	5.488E-19	214	0.398	0.402	2v6kA.pdb.gz	Structure of Bacterial Glutathione-S-Transferase Maleyl Pyruvate Isomerase and Implications for Mechanism of Isomerisation.
14	PDB:1e6bA	0.832	0.923	1.218E-18	194	0.435	0.485	1e6bA.pdb.gz
15	AFDB:O86043	0.913	0.930	1.249E-18	212	0.394	0.401	O86043.pdb.gz	NAGL_RALSP Maleylpyruvate isomerase OS=Ralstonia sp. OX=54061 GN=nagL PE=1 SV=1
16	PDB:4pnfB	0.801	0.784	3.769E-11	221	0.287	0.281	4pnfB.pdb.gz	Comparison of epsilon- and delta-class glutathione S-transferases: the crystal structures of the glutathione S-transferases DmGSTE6 and DmGSTE7 from Drosophila melanogaster.
17	PDB:4pngB	0.800	0.777	7.206E-11	223	0.301	0.291	4pngB.pdb.gz	Comparison of epsilon- and delta-class glutathione S-transferases: the crystal structures of the glutathione S-transferases DmGSTE6 and DmGSTE7 from Drosophila melanogaster.
18	PDB:5f0gA	0.725	0.753	1.768E-10	207	0.231	0.242	5f0gA.pdb.gz
19	PDB:5o84A	0.776	0.776	4.125E-10	216	0.241	0.241	5o84A.pdb.gz
20	PDB:6mhcA	0.756	0.676	5.035E-10	244	0.218	0.193	6mhcA.pdb.gz	Structure-Based Design of N-(5-Phenylthiazol-2-yl)acrylamides as Novel and Potent Glutathione S-Transferase Omega 1 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43708	6.86e-162	447	216	1.000	1.000	MAAI_HUMAN Maleylacetoacetate isomerase OS=Homo sapiens OX=9606 GN=GSTZ1 PE=1 SV=3
2	Q9WVL0	1.44e-134	378	216	0.843	0.843	MAAI_MOUSE Maleylacetoacetate isomerase OS=Mus musculus OX=10090 GN=Gstz1 PE=1 SV=1
3	X1WBU0	5.26e-104	301	216	0.644	0.644	X1WBU0_DANRE maleylacetoacetate isomerase OS=Danio rerio OX=7955 GN=zgc:113898 PE=1 SV=2
4	Q6DGL3	5.90e-104	301	220	0.644	0.632	Q6DGL3_DANRE maleylacetoacetate isomerase OS=Danio rerio OX=7955 GN=zgc:92869 PE=1 SV=1
5	Q9VHD3	2.15e-88	262	246	0.565	0.496	MAAI1_DROME Probable maleylacetoacetate isomerase 1 OS=Drosophila melanogaster OX=7227 GN=GstZ1 PE=1 SV=1
6	Q9VHD2	9.85e-85	252	227	0.574	0.546	MAAI2_DROME Probable maleylacetoacetate isomerase 2 OS=Drosophila melanogaster OX=7227 GN=GstZ2 PE=1 SV=1
7	X1WD04	5.97e-73	220	160	0.477	0.644	X1WD04_DANRE maleylacetoacetate isomerase OS=Danio rerio OX=7955 GN=zgc:113898 PE=1 SV=2
8	Q18938	1.20e-65	203	214	0.495	0.500	MAAI_CAEEL Probable maleylacetoacetate isomerase OS=Caenorhabditis elegans OX=6239 GN=gst-42 PE=1 SV=1
9	Q9ZVQ3	3.10e-62	195	221	0.463	0.452	GSTZ1_ARATH Glutathione S-transferase Z1 OS=Arabidopsis thaliana OX=3702 GN=GSTZ1 PE=1 SV=1
10	Q9ZVQ4	2.35e-60	190	223	0.449	0.435	GSTZ2_ARATH Glutathione S-transferase Z2 OS=Arabidopsis thaliana OX=3702 GN=GSTZ2 PE=3 SV=1
11	O43123	2.55e-52	170	230	0.458	0.430	MAAI_EMENI Maleylacetoacetate isomerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=maiA PE=1 SV=1
12	O86043	5.95e-45	150	212	0.394	0.401	NAGL_RALSP Maleylpyruvate isomerase OS=Ralstonia sp. OX=54061 GN=nagL PE=1 SV=1
13	Q5U3M8	8.78e-15	72.8	240	0.250	0.225	Q5U3M8_DANRE Glutathione S-transferase omega OS=Danio rerio OX=7955 GN=zgc:101897 PE=1 SV=1
14	A1ZB72	9.44e-14	69.7	223	0.292	0.283	A1ZB72_DROME Glutathione S transferase E7 OS=Drosophila melanogaster OX=7227 GN=GstE7 PE=1 SV=1
15	Q8MR33	9.69e-14	69.7	229	0.292	0.275	Q8MR33_DROME LD04004p (Fragment) OS=Drosophila melanogaster OX=7227 GN=GstE7 PE=2 SV=1
16	A1ZB71	1.93e-13	68.9	222	0.282	0.275	A1ZB71_DROME Glutathione S transferase E6 OS=Drosophila melanogaster OX=7227 GN=GstE6 PE=1 SV=1
17	Q7JZM3	2.50e-13	68.6	231	0.282	0.264	Q7JZM3_DROME RE21095p (Fragment) OS=Drosophila melanogaster OX=7227 GN=GstE6 PE=1 SV=1
18	P78417	3.27e-12	65.9	241	0.245	0.220	GSTO1_HUMAN Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1 PE=1 SV=2
19	Q9FUT0	6.50e-12	64.7	240	0.255	0.229	GSTU9_ARATH Glutathione S-transferase U9 OS=Arabidopsis thaliana OX=3702 GN=GSTU9 PE=2 SV=1
20	C1BFM5	7.92e-12	64.7	239	0.236	0.213	C1BFM5_ONCMY Glutathione S-transferase omega OS=Oncorhynchus mykiss OX=8022 GN=GSTO1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00043 GST_C	8.5	18.0	Glutathione S-transferase, C-terminal domain
2	PF13410 GST_C_2	3.3e+02	12.6	Glutathione S-transferase, C-terminal domain
3	PF14497 GST_C_3	0.057	24.9	Glutathione S-transferase, C-terminal domain
4	PF02798 GST_N	6.3e-12	57.0	Glutathione S-transferase, N-terminal domain
5	PF13409 GST_N_2	1.9e-11	55.5	Glutathione S-transferase, N-terminal domain
6	PF13417 GST_N_3	2e-12	58.6	Glutathione S-transferase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216465

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385080	0.986	Fumarylacetoacetase
2	9606.ENSP00000283871	0.985	Homogentisate 1,2-dioxygenase
3	9606.ENSP00000381607	0.929	Glutathione S-transferase P
4	9606.ENSP00000295256	0.913	Hematopoietic prostaglandin D synthase
5	9606.ENSP00000311469	0.908	Glutathione S-transferase Mu 1
6	9606.ENSP00000241337	0.907	Glutathione S-transferase Mu 2
7	9606.ENSP00000290765	0.891	Glutathione S-transferase theta-2B
8	9606.ENSP00000256594	0.872	Glutathione S-transferase Mu 3
9	9606.ENSP00000256593	0.836	Glutathione S-transferase Mu 5
10	9606.ENSP00000420168	0.836	Glutathione S-transferase A2
11	9606.ENSP00000360002	0.827	Glutathione S-transferase A4
12	9606.ENSP00000358851	0.825	Glutathione S-transferase Mu 4
13	9606.ENSP00000360028	0.780	Soluble glutathione S-transferases
14	9606.ENSP00000335620	0.733	Glutathione S-transferase A1
15	9606.ENSP00000211122	0.723	Glutathione S-transferase A3
16	9606.ENSP00000345023	0.721	Glutathione S-transferase omega-2
17	9606.ENSP00000358727	0.717	Glutathione S-transferase omega-1
18	9606.ENSP00000298351	0.707	Calcium permeable stress-gated cation channel 1
19	9606.ENSP00000219169	0.694	Nuclear transport factor 2
20	9606.ENSP00000276590	0.689	Endoribonuclease LACTB2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004364	0.999	glutathione transferase activity
GO:0005488	0.971	binding
GO:0005515	0.774	protein binding
GO:0016491	0.639	oxidoreductase activity
GO:0042802	0.341	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0044238	0.998	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0019752	0.991	carboxylic acid metabolic process
GO:0044248	0.985	cellular catabolic process
GO:0044282	0.979	small molecule catabolic process
GO:1901575	0.978	organic substance catabolic process
GO:0009072	0.977	aromatic amino acid metabolic process
GO:1902221	0.950	erythrose 4-phosphate/phosphoenolpyruvate family amino acid metabolic process
GO:0046395	0.939	carboxylic acid catabolic process
GO:1901606	0.918	alpha-amino acid catabolic process
GO:1901361	0.905	organic cyclic compound catabolic process
GO:0019439	0.901	aromatic compound catabolic process
GO:0009074	0.864	aromatic amino acid family catabolic process
GO:0006558	0.802	L-phenylalanine metabolic process
GO:0009063	0.640	amino acid catabolic process
GO:0006749	0.554	glutathione metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.994	intracellular organelle lumen
GO:0005739	0.979	mitochondrion
GO:0005829	0.971	cytosol
GO:0005759	0.458	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.5.1.18	0.999	glutathione transferase.
EC:1.-.-.-	0.639	Oxidoreductases.

[back to server]