StarFunc result for job id O43709

User Input

>input (281 residues)
MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDI
GCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIPFKPGTFDGCI
SISAVQWLCNANKKSENPAKRLYCFFASLFSVLVRGSRAVLQLYPENSEQLELITTQATK
AGFSGGMVVDYPNSAKAKKFYLCLFSGPSTFIPEGLSENQDEVEPRESVFTNERFPLRMS
RRGMVRKSRAWVLEKKERHRRQGREVRPDTQYTGRKRKPRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43709	1.000	1.000	3.422E-59	281	1.000	1.000	O43709.pdb.gz	BUD23_HUMAN Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Homo sapiens OX=9606 GN=BUD23 PE=1 SV=2
2	PDB:7wttq	0.710	0.847	3.553E-43	235	0.836	1.000	7wttq.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
3	AFDB:Q9LVD0	0.722	0.702	7.509E-39	289	0.548	0.533	Q9LVD0.pdb.gz	RID2_ARATH 18S rRNA (guanine-N(7))-methyltransferase RID2 OS=Arabidopsis thaliana OX=3702 GN=RID2 PE=1 SV=1
4	AFDB:P25627	0.704	0.720	7.083E-34	275	0.477	0.487	P25627.pdb.gz	BUD23_YEAST 18S rRNA (guanine(1575)-N(7))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD23 PE=1 SV=1
5	AFDB:Q10162	0.711	0.745	4.281E-33	268	0.456	0.478	Q10162.pdb.gz	BUD23_SCHPO 18S rRNA (guanine-N(7))-methyltransferase bud23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bud23 PE=3 SV=1
6	AFDB:Q583K3	0.704	0.524	8.792E-33	379	0.448	0.332	Q583K3.pdb.gz	Q583K3_TRYB2 18S rRNA (guanine(1575)-N(7))-methyltransferase Bud23 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.29M18.340 PE=3 SV=1
7	AFDB:F2Z3D9	0.501	0.728	2.114E-26	193	0.498	0.725	F2Z3D9.pdb.gz
8	AFDB:P9WKL5	0.399	0.457	5.679E-12	241	0.125	0.145	P9WKL5.pdb.gz	HTM_MYCTU 2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=htm PE=1 SV=1
9	AFDB:Q9LSR5	0.488	0.471	6.402E-12	292	0.128	0.123	Q9LSR5.pdb.gz	Q9LSR5_ARATH At5g54400 OS=Arabidopsis thaliana OX=3702 GN=At5g54400 PE=2 SV=1
10	AFDB:P9WFR3	0.480	0.568	1.034E-11	234	0.157	0.188	P9WFR3.pdb.gz	MENG_MYCTU Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=menG PE=1 SV=1
11	AFDB:P34666	0.452	0.446	1.671E-11	285	0.146	0.144	P34666.pdb.gz	COQ5_CAEEL 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-5 PE=3 SV=2
12	PDB:5wp4A	0.429	0.261	1.878E-11	485	0.135	0.078	5wp4A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
13	PDB:5wp5A	0.469	0.298	7.922E-11	463	0.117	0.071	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
14	PDB:5f8cB	0.419	0.335	8.931E-11	363	0.125	0.096	5f8cB.pdb.gz
15	PDB:4ineA	0.435	0.301	1.532E-10	431	0.164	0.107	4ineA.pdb.gz	Crystal structure of N-methyl transferase (PMT-2) from Caenorhabditis elegant complexed with S-adenosyl homocysteine and phosphoethanolamine
16	PDB:3cjtA	0.434	0.476	2.331E-10	254	0.135	0.150	3cjtA.pdb.gz	Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.
17	PDB:4kdcA	0.498	0.627	2.791E-10	217	0.100	0.129	4kdcA.pdb.gz
18	PDB:7bggA	0.402	0.505	3.767E-10	216	0.110	0.144	7bggA.pdb.gz	Structural basis of O-methylation of (2-heptyl-)1-hydroxyquinolin-4(1H)-one and related compounds by the heterocyclic toxin methyltransferase Rv0560c of Mycobacterium tuberculosis.
19	PDB:5m58A	0.451	0.542	4.788E-10	230	0.128	0.157	5m58A.pdb.gz	Crystal Structure and Catalytic Mechanism of CouO, a Versatile C-Methyltransferase from Streptomyces rishiriensis.
20	PDB:4oqdC	0.485	0.559	5.732E-10	241	0.142	0.166	4oqdC.pdb.gz	Production of a novel N-monomethylated dideoxysugar.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43709	0.0	581	281	1.000	1.000	BUD23_HUMAN Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Homo sapiens OX=9606 GN=BUD23 PE=1 SV=2
2	Q9LVD0	1.40e-101	300	289	0.544	0.529	RID2_ARATH 18S rRNA (guanine-N(7))-methyltransferase RID2 OS=Arabidopsis thaliana OX=3702 GN=RID2 PE=1 SV=1
3	P25627	6.08e-85	257	275	0.491	0.502	BUD23_YEAST 18S rRNA (guanine(1575)-N(7))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD23 PE=1 SV=1
4	Q10162	2.24e-81	248	268	0.463	0.485	BUD23_SCHPO 18S rRNA (guanine-N(7))-methyltransferase bud23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bud23 PE=3 SV=1
5	Q583K3	2.25e-61	200	379	0.459	0.340	Q583K3_TRYB2 18S rRNA (guanine(1575)-N(7))-methyltransferase Bud23 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.29M18.340 PE=3 SV=1
6	P12999	1.48e-08	56.6	251	0.142	0.159	BIOC_ECOLI Malonyl-[acyl-carrier protein] O-methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=bioC PE=1 SV=2
7	P26236	4.84e-06	48.9	224	0.139	0.174	BCHM_RHOCA Magnesium-protoporphyrin O-methyltransferase OS=Rhodobacter capsulatus OX=1061 GN=bchM PE=1 SV=1
8	Q5TEU4	3.43e-04	43.9	345	0.110	0.090	NDUF5_HUMAN Arginine-hydroxylase NDUFAF5, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAF5 PE=1 SV=1
9	Q8N6F8	8.63e-04	42.4	245	0.107	0.122	MET27_HUMAN Methyltransferase-like protein 27 OS=Homo sapiens OX=9606 GN=METTL27 PE=1 SV=2
10	Q80Y20	0.002	41.6	664	0.089	0.038	ALKB8_MOUSE Alkylated DNA repair protein alkB homolog 8 OS=Mus musculus OX=10090 GN=Alkbh8 PE=1 SV=1
11	Q9TYP1	0.015	38.9	334	0.121	0.102	STRM1_CAEEL Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans OX=6239 GN=strm-1 PE=1 SV=2
12	O74529	0.016	38.5	260	0.107	0.115	YJ48_SCHPO Uncharacterized methyltransferase C70.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC70.08c PE=3 SV=1
13	Q96BT7	0.020	38.9	664	0.082	0.035	ALKB8_HUMAN Alkylated DNA repair protein alkB homolog 8 OS=Homo sapiens OX=9606 GN=ALKBH8 PE=1 SV=2
14	E5KIC0	0.026	37.7	245	0.121	0.139	CYPM_STRSQ Cypemycin N-terminal methyltransferase OS=Streptomyces sp. OX=1931 GN=cypM PE=1 SV=1
15	P9WKL5	0.072	36.2	241	0.057	0.066	HTM_MYCTU 2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=htm PE=1 SV=1
16	Q9P272	0.083	36.6	454	0.107	0.066	TRM9B_HUMAN Probable tRNA methyltransferase 9B OS=Homo sapiens OX=9606 GN=TRMT9B PE=2 SV=3
17	A2APY7	0.095	36.2	343	0.082	0.067	NDUF5_MOUSE Arginine-hydroxylase NDUFAF5, mitochondrial OS=Mus musculus OX=10090 GN=Ndufaf5 PE=1 SV=1
18	P49957	0.096	36.2	279	0.121	0.122	TRM9_YEAST tRNA (carboxymethyluridine(34)-5-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM9 PE=1 SV=1
19	P13255	0.10	36.2	293	0.096	0.092	GNMT_RAT Glycine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Gnmt PE=1 SV=2
20	Q9QXF8	0.10	36.2	293	0.096	0.092	GNMT_MOUSE Glycine N-methyltransferase OS=Mus musculus OX=10090 GN=Gnmt PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08241 Methyltransf_11	3.5e-07	42.1	Methyltransferase domain
2	PF08242 Methyltransf_12	0.42	22.7	Methyltransferase domain
3	PF13489 Methyltransf_23	0.092	24.1	Methyltransferase domain
4	PF13649 Methyltransf_25	3.3e-07	42.2	Methyltransferase domain
5	PF13847 Methyltransf_31	0.17	23.1	Methyltransferase domain
6	PF13679 Methyltransf_32	1.4e+02	13.8	Methyltransferase domain
7	PF03848 TehB	3.5e+02	12.0	Tellurite resistance protein TehB
8	PF05724 TPMT	5e+02	11.7	Thiopurine S-methyltransferase (TPMT)
9	PF12589 WBS_methylT	3.6e-13	61.4	Methyltransferase involved in Williams-Beuren syndrome

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000032949

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000031867	0.969	LTV1 homolog
2	9598.ENSPTRP00000031035	0.960	Uncharacterized protein
3	9598.ENSPTRP00000014150	0.951	May play a role in mRNA degradation.
4	9598.ENSPTRP00000020608	0.946	Partner of NOB1 homolog
5	9598.ENSPTRP00000006597	0.944	Uncharacterized protein
6	9598.ENSPTRP00000060220	0.944	Uncharacterized protein
7	9598.ENSPTRP00000014591	0.932	TSR1, 20S rRNA accumulation, homolog
8	9598.ENSPTRP00000008899	0.921	KRR1 small subunit processome component
9	9598.ENSPTRP00000046864	0.913	60S ribosome subunit biogenesis protein NIP7 homolog
10	9598.ENSPTRP00000029277	0.903	RIO kinase 2
11	9598.ENSPTRP00000005365	0.856	BRCA2 and CDKN1A-interacting protein
12	9598.ENSPTRP00000009525	0.849	RNA helicase
13	9598.ENSPTRP00000050689	0.842	Uncharacterized protein
14	9598.ENSPTRP00000016175	0.837	pre-rRNA processing protein FTSJ3
15	9598.ENSPTRP00000047047	0.832	Uncharacterized protein
16	9598.ENSPTRP00000000463	0.830	Ribosome assembly factor mrt4
17	9598.ENSPTRP00000008761	0.827	tRNA (guanine-N(7)-)-methyltransferase
18	9598.ENSPTRP00000027308	0.822	NOP14 nucleolar protein homolog
19	9598.ENSPTRP00000027340	0.810	Uncharacterized protein
20	9598.ENSPTRP00000030220	0.800	Serine/threonine-protein kinase RIO1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0008649	1.000	rRNA methyltransferase activity
GO:0046982	0.998	protein heterodimerization activity
GO:0016435	0.768	rRNA (guanine) methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0034641	0.996	cellular nitrogen compound metabolic process
GO:0010467	0.995	gene expression
GO:0034470	0.988	ncRNA processing
GO:0042254	0.986	ribosome biogenesis
GO:0000154	0.978	rRNA modification
GO:0050789	0.976	regulation of biological process
GO:0050794	0.969	regulation of cellular process
GO:0043414	0.948	macromolecule methylation
GO:0031167	0.934	rRNA methylation
GO:0048518	0.925	positive regulation of biological process
GO:0019222	0.924	regulation of metabolic process
GO:0009893	0.834	positive regulation of metabolic process
GO:0051171	0.822	regulation of nitrogen compound metabolic process
GO:0031323	0.796	regulation of cellular metabolic process
GO:0060255	0.776	regulation of macromolecule metabolic process
GO:0080090	0.765	regulation of primary metabolic process
GO:0048522	0.651	positive regulation of cellular process
GO:0010604	0.534	positive regulation of macromolecule metabolic process
GO:0010468	0.502	regulation of gene expression
GO:0051173	0.480	positive regulation of nitrogen compound metabolic process
GO:0070476	0.448	rRNA (guanine-N7)-methylation
GO:0031325	0.368	positive regulation of cellular metabolic process
GO:0019219	0.364	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.353	regulation of RNA metabolic process
GO:0051254	0.321	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005730	1.000	nucleolus
GO:0005654	0.995	nucleoplasm
GO:0048471	0.670	perinuclear region of cytoplasm
GO:0005829	0.380	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]