StarFunc result for job id O43711

User Input

>input (291 residues)
MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLP
ASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSL
GGLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICE
LEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLM
LQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43711	0.999	0.999	4.847E-44	291	1.000	1.000	O43711.pdb.gz	TLX3_HUMAN T-cell leukemia homeobox protein 3 OS=Homo sapiens OX=9606 GN=TLX3 PE=1 SV=3
2	AFDB:Q9QX99	0.343	0.303	4.589E-24	333	0.670	0.586	Q9QX99.pdb.gz	Q9QX99_MOUSE T-cell leukemia, homeobox 1 OS=Mus musculus OX=10090 GN=Tlx1 PE=1 SV=1
3	AFDB:Q504H8	0.234	0.229	1.182E-8	297	0.289	0.283	Q504H8.pdb.gz	HMX3_DANRE Homeobox protein HMX3 OS=Danio rerio OX=7955 GN=hmx3 PE=2 SV=1
4	AFDB:Q58A08	0.202	0.172	2.250E-7	344	0.206	0.174	Q58A08.pdb.gz	Q58A08_ONCMY NK2 homeobox 1b OS=Oncorhynchus mykiss OX=8022 GN=Nkx2-4b PE=2 SV=1
5	AFDB:Q804R0	0.206	0.233	2.941E-7	257	0.203	0.230	Q804R0.pdb.gz	LBX2_DANRE Transcription factor LBX2 OS=Danio rerio OX=7955 GN=lbx2 PE=1 SV=1
6	AFDB:B3DH68	0.210	0.177	3.362E-7	346	0.244	0.205	B3DH68.pdb.gz
7	AFDB:Q06615	0.235	0.286	5.373E-7	236	0.216	0.267	Q06615.pdb.gz	NOTO_XENLA Homeobox protein notochord OS=Xenopus laevis OX=8355 GN=noto PE=2 SV=1
8	AFDB:P46665	0.254	0.225	5.745E-7	336	0.220	0.190	P46665.pdb.gz	HAT14_ARATH Homeobox-leucine zipper protein HAT14 OS=Arabidopsis thaliana OX=3702 GN=HAT14 PE=2 SV=3
9	AFDB:P09632	0.208	0.247	6.143E-7	243	0.175	0.210	P09632.pdb.gz	HXB8_MOUSE Homeobox protein Hox-B8 OS=Mus musculus OX=10090 GN=Hoxb8 PE=1 SV=2
10	AFDB:Q61670	0.198	0.123	6.143E-7	476	0.265	0.162	Q61670.pdb.gz	HLX_MOUSE H2.0-like homeobox protein OS=Mus musculus OX=10090 GN=Hlx PE=2 SV=1
11	PDB:4egcA	0.174	0.094	1.095E-2	539	0.052	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.170	0.616	5.463E-2	73	0.048	0.192	2hi3A.pdb.gz
13	PDB:5aj0BZ	0.143	0.415	1.188	86	0.031	0.105	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
14	PDB:5nr5A	0.125	0.298	1.359	113	0.062	0.159	5nr5A.pdb.gz
15	PDB:7fbyA	0.129	0.226	1.661	153	0.014	0.026	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
16	PDB:7awtE	0.116	0.206	1.899	156	0.021	0.038	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
17	PDB:5jaaA	0.097	0.227	2.171	102	0.034	0.098	5jaaA.pdb.gz
18	PDB:3jb9W	0.152	0.107	2.482	426	0.082	0.056	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
19	PDB:7b93E	0.096	0.125	2.838	215	0.027	0.037	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
20	PDB:7ml4M	0.122	0.149	3.034	234	0.021	0.026	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43711	0.0	592	291	1.000	1.000	TLX3_HUMAN T-cell leukemia homeobox protein 3 OS=Homo sapiens OX=9606 GN=TLX3 PE=1 SV=3
2	O55144	0.0	590	291	0.997	0.997	TLX3_MOUSE T-cell leukemia homeobox protein 3 OS=Mus musculus OX=10090 GN=Tlx3 PE=2 SV=2
3	A0A2R8QHC0	1.71e-119	347	309	0.660	0.621	A0A2R8QHC0_DANRE T cell leukemia homeobox 2 OS=Danio rerio OX=7955 GN=Tlx-3a PE=4 SV=1
4	A1A5U3	3.91e-117	340	301	0.649	0.628	A1A5U3_DANRE T cell leukemia homeobox 2 OS=Danio rerio OX=7955 GN=tlx3a PE=2 SV=1
5	P43345	3.65e-106	313	332	0.629	0.551	TLX1_MOUSE T-cell leukemia homeobox protein 1 OS=Mus musculus OX=10090 GN=Tlx1 PE=1 SV=1
6	P31314	4.51e-103	306	330	0.522	0.461	TLX1_HUMAN T-cell leukemia homeobox protein 1 OS=Homo sapiens OX=9606 GN=TLX1 PE=1 SV=1
7	Q9QX99	7.44e-103	305	333	0.522	0.456	Q9QX99_MOUSE T-cell leukemia, homeobox 1 OS=Mus musculus OX=10090 GN=Tlx1 PE=1 SV=1
8	Q61663	1.21e-91	275	284	0.615	0.630	TLX2_MOUSE T-cell leukemia homeobox protein 2 OS=Mus musculus OX=10090 GN=Tlx2 PE=2 SV=1
9	O43763	5.87e-86	260	284	0.584	0.599	TLX2_HUMAN T-cell leukemia homeobox protein 2 OS=Homo sapiens OX=9606 GN=TLX2 PE=1 SV=2
10	Q9VD99	6.62e-62	200	307	0.399	0.378	Q9VD99_DROME Homeodomain-containing protein OS=Drosophila melanogaster OX=7227 GN=C15 PE=1 SV=2
11	Q7KS72	2.04e-61	199	339	0.399	0.342	Q7KS72_DROME C15 OS=Drosophila melanogaster OX=7227 GN=C15 PE=2 SV=1
12	F1QTJ6	1.89e-20	90.5	269	0.158	0.171	F1QTJ6_DANRE H6 family homeobox 2 OS=Danio rerio OX=7955 GN=hmx2 PE=4 SV=1
13	O70218	1.76e-19	89.0	332	0.141	0.123	HMX1_MOUSE Homeobox protein HMX1 OS=Mus musculus OX=10090 GN=Hmx1 PE=2 SV=1
14	Q504H8	2.32e-19	88.2	297	0.137	0.135	HMX3_DANRE Homeobox protein HMX3 OS=Danio rerio OX=7955 GN=hmx3 PE=2 SV=1
15	P43687	4.58e-19	86.7	273	0.158	0.168	HMX2_MOUSE Homeobox protein HMX2 OS=Mus musculus OX=10090 GN=Hmx2 PE=2 SV=3
16	A2RU54	7.88e-19	86.3	273	0.134	0.143	HMX2_HUMAN Homeobox protein HMX2 OS=Homo sapiens OX=9606 GN=HMX2 PE=2 SV=1
17	Q9DE09	3.28e-18	85.5	333	0.134	0.117	HMX1_CHICK Homeobox protein HMX1 OS=Gallus gallus OX=9031 GN=HMX1 PE=2 SV=1
18	Q90461	4.16e-18	83.6	241	0.127	0.154	Q90461_DANRE Floating head OS=Danio rerio OX=7955 GN=flh PE=2 SV=1
19	P42581	5.33e-18	85.1	356	0.134	0.110	HMX3_MOUSE Homeobox protein HMX3 OS=Mus musculus OX=10090 GN=Hmx3 PE=1 SV=3
20	P52954	5.71e-18	84.0	281	0.148	0.153	LBX1_HUMAN Transcription factor LBX1 OS=Homo sapiens OX=9606 GN=LBX1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	1.4e+02	13.8	Homeobox KN domain
2	PF00046 Homeodomain	5.7e-17	72.6	Homeodomain
3	PF11569 Homez	7	17.7	Homeodomain leucine-zipper encoding, Homez

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000005964

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000010444	0.672	Aristaless related homeobox
2	60711.ENSCSAP00000009814	0.663	PBX homeobox 3
3	60711.ENSCSAP00000009825	0.582	LIM homeobox transcription factor 1, beta
4	60711.ENSCSAP00000004024	0.568	PHD finger protein 6
5	60711.ENSCSAP00000016767	0.546	TAL bHLH transcription factor 1, erythroid differentiation factor
6	60711.ENSCSAP00000000777	0.543	LIM domain only 1 (rhombotin 1)
7	60711.ENSCSAP00000006905	0.532	LIM homeobox transcription factor 1, alpha
8	60711.ENSCSAP00000015794	0.531	ETS proto-oncogene 1, transcription factor
9	60711.ENSCSAP00000002791	0.519	LYL1, basic helix-loop-helix family member

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.852	DNA-binding transcription factor activity
GO:0000981	0.755	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.375	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0048856	0.965	anatomical structure development
GO:0009987	0.956	cellular process
GO:0007275	0.945	multicellular organism development
GO:0019222	0.739	regulation of metabolic process
GO:0048518	0.717	positive regulation of biological process
GO:0050793	0.674	regulation of developmental process
GO:0031323	0.634	regulation of cellular metabolic process
GO:0060255	0.633	regulation of macromolecule metabolic process
GO:0080090	0.631	regulation of primary metabolic process
GO:0051171	0.631	regulation of nitrogen compound metabolic process
GO:0048522	0.623	positive regulation of cellular process
GO:0010468	0.575	regulation of gene expression
GO:0019219	0.574	regulation of nucleobase-containing compound metabolic process
GO:0048731	0.566	system development
GO:0031326	0.555	regulation of cellular biosynthetic process
GO:0051252	0.555	regulation of RNA metabolic process
GO:0006355	0.554	regulation of DNA-templated transcription
GO:0009893	0.494	positive regulation of metabolic process
GO:0048519	0.475	negative regulation of biological process
GO:0010604	0.462	positive regulation of macromolecule metabolic process
GO:0048523	0.451	negative regulation of cellular process
GO:0006357	0.410	regulation of transcription by RNA polymerase II
GO:0050896	0.403	response to stimulus
GO:0051173	0.376	positive regulation of nitrogen compound metabolic process
GO:0031325	0.375	positive regulation of cellular metabolic process
GO:0045935	0.360	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.335	positive regulation of DNA-templated transcription
GO:0048513	0.334	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031974	0.996	membrane-enclosed lumen
GO:0005654	0.988	nucleoplasm
GO:0005737	0.524	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]