StarFunc result for job id O43715

User Input

>input (76 residues)
MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIE
GLEFMGHGKEKPENSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43715	1.000	1.000	3.027E-12	76	1.000	1.000	O43715.pdb.gz	TRIA1_HUMAN TP53-regulated inhibitor of apoptosis 1 OS=Homo sapiens OX=9606 GN=TRIAP1 PE=1 SV=1
2	AFDB:A9ULB4	0.894	0.872	1.243E-9	78	0.737	0.718	A9ULB4.pdb.gz	TRIA1_XENTR TP53-regulated inhibitor of apoptosis 1 OS=Xenopus tropicalis OX=8364 GN=triap1 PE=2 SV=1
3	PDB:6i3yA	0.848	0.870	2.476E-9	74	0.934	0.959	6i3yA.pdb.gz	Structural determinants of lipid specificity within Ups/PRELI lipid transfer proteins.
4	PDB:6i4yA	0.731	0.135	1.222E-6	429	0.776	0.138	6i4yA.pdb.gz	Structural determinants of lipid specificity within Ups/PRELI lipid transfer proteins.
5	AFDB:Q96VG1	0.723	0.794	1.363E-4	69	0.382	0.420	Q96VG1.pdb.gz	YBAI_SCHPO Uncharacterized protein C119.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC119.18 PE=3 SV=1
6	AFDB:O60200	0.683	0.609	1.494E-3	86	0.316	0.279	O60200.pdb.gz	MDM35_YEAST Mitochondrial distribution and morphology protein 35 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDM35 PE=1 SV=3
7	PDB:5jqmC	0.666	0.220	1.382E-2	236	0.303	0.097	5jqmC.pdb.gz
8	AFDB:Q9LZV6	0.364	0.144	1.449	263	0.224	0.065	Q9LZV6.pdb.gz	WRK62_ARATH Probable WRKY transcription factor 62 OS=Arabidopsis thaliana OX=3702 GN=WRKY62 PE=1 SV=2
9	AFDB:F4HXY8	0.452	0.229	2.519	166	0.224	0.102	F4HXY8.pdb.gz	F4HXY8_ARATH Ubiquinol-cytochrome C reductase hinge protein OS=Arabidopsis thaliana OX=3702 GN=At1g15120 PE=1 SV=1
10	AFDB:Q04667	0.293	0.153	2.519	175	0.118	0.051	Q04667.pdb.gz	HES3_RAT Transcription factor HES-3 OS=Rattus norvegicus OX=10116 GN=Hes3 PE=2 SV=1
11	PDB:1huwA	0.304	0.167	3.472	166	0.132	0.060	1huwA.pdb.gz
12	AFDB:A2AMZ4	0.465	0.476	3.871	74	0.171	0.176	A2AMZ4.pdb.gz	NDUF8_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 8 OS=Mus musculus OX=10090 GN=Ndufaf8 PE=1 SV=1
13	PDB:5nbdA	0.398	0.081	3.925	564	0.158	0.021	5nbdA.pdb.gz	Structural basis of inhibition of lipid-linked oligosaccharide flippase PglK by a conformational nanobody.
14	AFDB:A1L188	0.466	0.476	4.116	74	0.197	0.203	A1L188.pdb.gz	NDUF8_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 8 OS=Homo sapiens OX=9606 GN=NDUFAF8 PE=1 SV=1
15	AFDB:P0CX84	0.377	0.268	4.116	120	0.132	0.083	P0CX84.pdb.gz	RL35A_YEAST Large ribosomal subunit protein uL29A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL35A PE=1 SV=1
16	PDB:2hh7A	0.347	0.325	5.018	85	0.066	0.059	2hh7A.pdb.gz
17	PDB:3j6bT	0.225	0.126	5.018	209	0.132	0.048	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
18	PDB:4ohfB	0.412	0.090	5.018	458	0.118	0.020	4ohfB.pdb.gz	Allosteric regulation and substrate activation in cytosolic nucleotidase II from Legionella pneumophila.
19	PDB:5zonA	0.310	0.118	5.018	256	0.118	0.035	5zonA.pdb.gz	Identification and structural characterization of a histidinol phosphate phosphatase from Mycobacterium tuberculosis
20	PDB:5apnh	0.372	0.266	5.336	119	0.145	0.092	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43715	4.89e-53	160	76	1.000	1.000	TRIA1_HUMAN TP53-regulated inhibitor of apoptosis 1 OS=Homo sapiens OX=9606 GN=TRIAP1 PE=1 SV=1
2	Q9D8Z2	2.72e-52	159	76	0.987	0.987	TRIA1_MOUSE TP53-regulated inhibitor of apoptosis 1 OS=Mus musculus OX=10090 GN=Triap1 PE=1 SV=1
3	A9ULB4	2.47e-39	126	78	0.737	0.718	TRIA1_XENTR TP53-regulated inhibitor of apoptosis 1 OS=Xenopus tropicalis OX=8364 GN=triap1 PE=2 SV=1
4	Q96VG1	2.71e-15	65.5	69	0.382	0.420	YBAI_SCHPO Uncharacterized protein C119.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC119.18 PE=3 SV=1
5	O60200	3.08e-11	55.5	86	0.316	0.279	MDM35_YEAST Mitochondrial distribution and morphology protein 35 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDM35 PE=1 SV=3
6	Q8LEV7	0.74	29.6	252	0.184	0.056	6PGL5_ARATH Probable 6-phosphogluconolactonase 5 OS=Arabidopsis thaliana OX=3702 GN=PGL5 PE=2 SV=2
7	P38873	2.2	28.5	1557	0.197	0.010	KOG1_YEAST Target of rapamycin complex 1 subunit KOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KOG1 PE=1 SV=2
8	Q8BTT6	5.0	27.3	772	0.276	0.027	UTP25_MOUSE U3 small nucleolar RNA-associated protein 25 homolog OS=Mus musculus OX=10090 GN=Utp25 PE=1 SV=2
9	Q38E16	5.7	27.3	720	0.145	0.015	Q38E16_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1390 PE=4 SV=1
10	P20030	7.7	26.9	676	0.132	0.015	HSP7C_TRYBB Heat shock cognate HSP70 protein OS=Trypanosoma brucei brucei OX=5702 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10469 AKAP7_NLS	4.9e+02	12.0	AKAP7 2'5' RNA ligase-like domain
2	PF06747 CHCH	19	16.8	CHCH domain
3	PF05051 COX17	3.3	19.5	Cytochrome C oxidase copper chaperone (COX17)
4	PF16860 CX9C	15	17.0	CHCH-CHCH-like Cx9C, IMS import disulfide relay-system,
5	PF05676 NDUF_B7	2e+02	13.1	NADH-ubiquinone oxidoreductase B18 subunit (NDUFB7)
6	PF02320 UCR_hinge	29	16.3	Ubiquinol-cytochrome C reductase hinge protein
7	PF05254 UPF0203	1e-21	88.3	Uncharacterised protein family (UPF0203)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000005731

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000018002	0.991	PRELI domain containing 1
2	9601.ENSPPYP00000012493	0.946	PRELI domain containing 3B
3	9601.ENSPPYP00000010084	0.903	PRELI domain containing 3A
4	9601.ENSPPYP00000019381	0.779	Cytochrome c oxidase assembly homolog 19 (S. cerevisiae)
5	9601.ENSPPYP00000023518	0.744	Coiled-coil-helix-coiled-coil-helix domain containing 4
6	9601.ENSPPYP00000003760	0.732	Translocase of inner mitochondrial membrane 10 homolog (yeast)
7	9601.ENSPPYP00000017643	0.731	Pongo abelii heat shock 70kDa protein 4 (HSPA4), mRNA
8	9601.ENSPPYP00000001878	0.720	Mitochondrial trans-2-enoyl-CoA reductase
9	9601.ENSPPYP00000006656	0.717	Translocase of inner mitochondrial membrane 9 homolog (yeast)
10	9601.ENSPPYP00000014072	0.691	Tumor protein p53 inducible protein 3
11	9601.ENSPPYP00000015109	0.685	COX17 cytochrome c oxidase copper chaperone
12	9601.ENSPPYP00000018732	0.685	Uncharacterized protein
13	9601.ENSPPYP00000010494	0.675	Translocase of inner mitochondrial membrane 13 homolog (yeast)
14	9601.ENSPPYP00000007901	0.672	Sulfhydryl oxidase
15	9601.ENSPPYP00000020179	0.665	V-type proton ATPase subunit F
16	9601.ENSPPYP00000006063	0.663	Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP. Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9 (By similarity)
17	9601.ENSPPYP00000004996	0.657	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity)
18	9601.ENSPPYP00000010695	0.649	Uncharacterized protein DKFZp469G145
19	9601.ENSPPYP00000004060	0.618	Mitochondrial import inner membrane translocase subunit Tim10 B
20	9601.ENSPPYP00000005581	0.609	thymine-DNA glycosylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002039	1.000	p53 binding
GO:1990050	1.000	phosphatidic acid transfer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.969	regulation of cellular process
GO:0023051	0.959	regulation of signaling
GO:0010646	0.959	regulation of cell communication
GO:0048519	0.944	negative regulation of biological process
GO:0071840	0.930	cellular component organization or biogenesis
GO:0048583	0.926	regulation of response to stimulus
GO:0016043	0.924	cellular component organization
GO:0009966	0.919	regulation of signal transduction
GO:0051179	0.913	localization
GO:0033036	0.857	macromolecule localization
GO:0006810	0.830	transport
GO:0048523	0.824	negative regulation of cellular process
GO:0050896	0.794	response to stimulus
GO:0019222	0.740	regulation of metabolic process
GO:0048518	0.709	positive regulation of biological process
GO:0048522	0.700	positive regulation of cellular process
GO:0071702	0.681	organic substance transport
GO:0061024	0.644	membrane organization
GO:0010648	0.635	negative regulation of cell communication
GO:0023057	0.621	negative regulation of signaling
GO:0051726	0.615	regulation of cell cycle
GO:0051716	0.592	cellular response to stimulus
GO:0051171	0.579	regulation of nitrogen compound metabolic process
GO:0080090	0.564	regulation of primary metabolic process
GO:0065009	0.558	regulation of molecular function
GO:0048585	0.546	negative regulation of response to stimulus
GO:0060255	0.545	regulation of macromolecule metabolic process
GO:0006950	0.532	response to stress
GO:0031323	0.515	regulation of cellular metabolic process
GO:0051173	0.515	positive regulation of nitrogen compound metabolic process
GO:0010604	0.509	positive regulation of macromolecule metabolic process
GO:1902531	0.509	regulation of intracellular signal transduction
GO:0009968	0.468	negative regulation of signal transduction
GO:0042981	0.395	regulation of apoptotic process
GO:0050790	0.390	regulation of catalytic activity
GO:0033554	0.386	cellular response to stress
GO:0065008	0.354	regulation of biological quality
GO:0031325	0.326	positive regulation of cellular metabolic process
GO:0080134	0.323	regulation of response to stress
GO:0010821	0.323	regulation of mitochondrion organization
GO:0051246	0.323	regulation of protein metabolic process
GO:0008152	0.306	metabolic process
GO:0097035	0.303	regulation of membrane lipid distribution
GO:1902532	0.302	negative regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005654	0.995	nucleoplasm
GO:0032991	0.988	protein-containing complex
GO:0005740	0.961	mitochondrial envelope
GO:0005758	0.718	mitochondrial intermembrane space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]