StarFunc result for job id O43734

User Input

>input (574 residues)
MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPT
MLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCS
AVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSL
GGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPL
RSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQ
PALPGQPLPGASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQDQPHHQPPNR
AGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDT
AMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVE
GAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYS
WPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43734	1.000	1.000	6.460E-88	574	1.000	1.000	O43734.pdb.gz	CIKS_HUMAN E3 ubiquitin ligase TRAF3IP2 OS=Homo sapiens OX=9606 GN=TRAF3IP2 PE=1 SV=3
2	PDB:7anwA	0.163	0.148	1.148E-3	645	0.049	0.043	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
3	PDB:1ys6B	0.158	0.349	9.283E-2	227	0.040	0.101	1ys6B.pdb.gz	Crystal structure of the response regulatory protein PrrA from Mycobacterium Tuberculosis
4	AFDB:Q54SP4	0.155	0.068	9.381E-2	1546	0.101	0.038	Q54SP4.pdb.gz	DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum OX=44689 GN=dhkD PE=2 SV=1
5	PDB:5zheA	0.116	0.227	9.851E-2	206	0.042	0.117	5zheA.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
6	PDB:2gwrA	0.147	0.329	1.249E-1	225	0.031	0.080	2gwrA.pdb.gz	Domain orientation in the inactive response regulator Mycobacterium tuberculosis MtrA provides a barrier to activation.
7	PDB:3hzhA	0.151	0.493	1.325E-1	134	0.030	0.127	3hzhA.pdb.gz	Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate.
8	PDB:4lc9A	0.099	0.100	2.008E-1	567	0.017	0.018	4lc9A.pdb.gz	Structural basis for regulation of human glucokinase by glucokinase regulatory protein.
9	PDB:3breB	0.084	0.128	2.131E-1	328	0.033	0.058	3breB.pdb.gz	Phosphorylation-independent regulation of the diguanylate cyclase WspR.
10	PDB:6ez3A	0.073	0.149	2.702E-1	220	0.024	0.064	6ez3A.pdb.gz
11	AFDB:Q5VK71	0.061	0.052	2.731E-1	698	0.138	0.113	Q5VK71.pdb.gz	AKAP8_CANLF A-kinase anchor protein 8 OS=Canis lupus familiaris OX=9615 GN=AKAP8 PE=1 SV=1
12	AFDB:Q6SJR1	0.046	0.039	2.731E-1	720	0.150	0.119	Q6SJR1.pdb.gz	TAF4_ARATH Transcription initiation factor TFIID subunit 4 OS=Arabidopsis thaliana OX=3702 GN=TAF4 PE=1 SV=1
13	PDB:1s8nA	0.147	0.371	2.868E-1	190	0.030	0.089	1s8nA.pdb.gz	The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
14	AFDB:Q9FNM7	0.116	0.086	3.263E-1	850	0.141	0.095	Q9FNM7.pdb.gz	RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana OX=3702 GN=RH26 PE=1 SV=2
15	AFDB:Q09314	0.090	0.077	3.675E-1	759	0.150	0.113	Q09314.pdb.gz	NOP1_CAEEL Pseudocleavage protein nop-1 OS=Caenorhabditis elegans OX=6239 GN=nop-1 PE=2 SV=2
16	PDB:2g37B	0.109	0.170	3.859E-1	300	0.035	0.067	2g37B.pdb.gz	Structure and Kinetics of Monofunctional Proline Dehydrogenase from Thermus thermophilus.
17	AFDB:D6RIF6	0.060	0.078	4.660E-1	414	0.117	0.162	D6RIF6.pdb.gz	D6RIF6_HUMAN SLAIN motif family member 2 OS=Homo sapiens OX=9606 GN=SLAIN2 PE=1 SV=1
18	AFDB:Q9FJX6	0.071	0.049	5.909E-1	899	0.127	0.081	Q9FJX6.pdb.gz	FH6_ARATH Formin-like protein 6 OS=Arabidopsis thaliana OX=3702 GN=FH6 PE=2 SV=1
19	AFDB:Q584L5	0.077	0.087	6.270E-1	502	0.110	0.125	Q584L5.pdb.gz	Q584L5_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.140 PE=4 SV=1
20	AFDB:Q587H5	0.161	0.068	9.501E-1	1501	0.129	0.049	Q587H5.pdb.gz	Q587H5_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=10C8.160 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43734	0.0	1177	574	1.000	1.000	CIKS_HUMAN E3 ubiquitin ligase TRAF3IP2 OS=Homo sapiens OX=9606 GN=TRAF3IP2 PE=1 SV=3
2	Q8C0E5	0.0	800	555	0.779	0.805	Q8C0E5_MOUSE SEFIR domain-containing protein OS=Mus musculus OX=10090 GN=Traf3ip2 PE=1 SV=1
3	Q8N7N6	0.0	801	555	0.780	0.807	CIKS_MOUSE E3 ubiquitin ligase TRAF3IP2 OS=Mus musculus OX=10090 GN=Traf3ip2 PE=1 SV=1
4	Q9C0C9	2.7	33.5	1292	0.047	0.021	UBE2O_HUMAN (E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3
5	Q9VWY6	3.9	32.7	328	0.057	0.101	TAF8_DROME Transcription initiation factor TFIID subunit 8 OS=Drosophila melanogaster OX=7227 GN=Taf8 PE=1 SV=1
6	O35664	5.7	32.3	513	0.042	0.047	INAR2_MOUSE Interferon alpha/beta receptor 2 OS=Mus musculus OX=10090 GN=Ifnar2 PE=1 SV=2
7	Q9VJY9	6.7	32.0	465	0.033	0.041	LOQS_DROME Protein Loquacious OS=Drosophila melanogaster OX=7227 GN=loqs PE=1 SV=2
8	Q6ZPJ3	7.1	32.0	1288	0.047	0.021	UBE2O_MOUSE (E3-independent) E2 ubiquitin-conjugating enzyme UBE2O OS=Mus musculus OX=10090 GN=Ube2o PE=1 SV=3
9	Q9LQN6	8.6	31.6	662	0.047	0.041	P2C04_ARATH Probable protein phosphatase 2C 4 OS=Arabidopsis thaliana OX=3702 GN=PLL5 PE=2 SV=1
10	Q96I59	9.6	31.6	477	0.044	0.052	SYNM_HUMAN Probable asparagine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=NARS2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08357 SEFIR	8.3e-33	125.2	SEFIR domain
2	PF13676 TIR_2	0.039	26.0	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000031614

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000006096	0.982	Belongs to the TNF receptor-associated factor family.
2	9598.ENSPTRP00000024164	0.949	Uncharacterized protein
3	9598.ENSPTRP00000011503	0.865	Belongs to the TNF receptor-associated factor family.
4	9598.ENSPTRP00000003288	0.805	Belongs to the TNF receptor-associated factor family.
5	9598.ENSPTRP00000061184	0.805	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
6	9598.ENSPTRP00000024871	0.660	Tumor necrosis factor receptor superfamily, member 13C
7	9598.ENSPTRP00000027829	0.657	Chemokine (C-X-C motif) ligand 13
8	9598.ENSPTRP00000029779	0.565	TNFAIP3 interacting protein 1
9	9598.ENSPTRP00000057993	0.545	Mitogen-activated protein kinase kinase kinase 7
10	9598.ENSPTRP00000045154	0.543	Uncharacterized protein
11	9598.ENSPTRP00000022068	0.534	C-X-C chemokine receptor type 2
12	9598.ENSPTRP00000000096	0.530	Tumor necrosis factor receptor superfamily, member 14 (Herpesvirus entry mediator)
13	9598.ENSPTRP00000031222	0.524	Uncharacterized protein
14	9598.ENSPTRP00000001450	0.520	Uncharacterized protein
15	9598.ENSPTRP00000041216	0.520	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
16	9598.ENSPTRP00000025196	0.506	Interleukin 17 receptor C
17	9598.ENSPTRP00000003199	0.504	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon
18	9598.ENSPTRP00000036949	0.502	Belongs to the TNF receptor-associated factor family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0005102	0.443	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0023052	0.987	signaling
GO:0048518	0.974	positive regulation of biological process
GO:0007165	0.970	signal transduction
GO:0006952	0.962	defense response
GO:1902531	0.960	regulation of intracellular signal transduction
GO:0009967	0.957	positive regulation of signal transduction
GO:0032101	0.947	regulation of response to external stimulus
GO:0031347	0.943	regulation of defense response
GO:0019221	0.936	cytokine-mediated signaling pathway
GO:0044238	0.930	primary metabolic process
GO:0071704	0.929	organic substance metabolic process
GO:0006807	0.898	nitrogen compound metabolic process
GO:0002831	0.889	regulation of response to biotic stimulus
GO:0019538	0.886	protein metabolic process
GO:0019222	0.860	regulation of metabolic process
GO:0036211	0.852	protein modification process
GO:1902533	0.832	positive regulation of intracellular signal transduction
GO:0060255	0.811	regulation of macromolecule metabolic process
GO:0043122	0.804	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0010468	0.781	regulation of gene expression
GO:0016567	0.771	protein ubiquitination
GO:0000209	0.753	protein polyubiquitination
GO:0006954	0.713	inflammatory response
GO:0009893	0.713	positive regulation of metabolic process
GO:0043123	0.707	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0010604	0.696	positive regulation of macromolecule metabolic process
GO:0051171	0.691	regulation of nitrogen compound metabolic process
GO:0080090	0.688	regulation of primary metabolic process
GO:0031323	0.637	regulation of cellular metabolic process
GO:0019219	0.585	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.559	regulation of RNA metabolic process
GO:0002376	0.491	immune system process
GO:0048519	0.442	negative regulation of biological process
GO:0048523	0.424	negative regulation of cellular process
GO:0010628	0.420	positive regulation of gene expression
GO:0009889	0.392	regulation of biosynthetic process
GO:0031326	0.379	regulation of cellular biosynthetic process
GO:0010556	0.377	regulation of macromolecule biosynthetic process
GO:0051239	0.372	regulation of multicellular organismal process
GO:0051173	0.358	positive regulation of nitrogen compound metabolic process
GO:0002682	0.346	regulation of immune system process
GO:0002684	0.342	positive regulation of immune system process
GO:0009605	0.312	response to external stimulus
GO:0051240	0.309	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005634	0.998	nucleus
GO:0031982	0.996	vesicle
GO:0031410	0.994	cytoplasmic vesicle
GO:0005829	0.807	cytosol
GO:0031981	0.603	nuclear lumen
GO:0016020	0.500	membrane
GO:0005654	0.492	nucleoplasm
GO:0012505	0.425	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]