StarFunc result for job id O43745

User Input

>input (196 residues)
MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAF
QLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKS
LEKMDVEQKMSIRILK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43745	1.000	1.000	1.299E-31	196	1.000	1.000	O43745.pdb.gz	CHP2_HUMAN Calcineurin B homologous protein 2 OS=Homo sapiens OX=9606 GN=CHP2 PE=1 SV=3
2	AFDB:Q810D1	0.961	0.961	3.578E-27	196	0.816	0.816	Q810D1.pdb.gz	CHP2_RAT Calcineurin B homologous protein 2 OS=Rattus norvegicus OX=10116 GN=Chp2 PE=1 SV=1
3	PDB:2becA	0.889	0.960	1.681E-25	181	0.923	1.000	2becA.pdb.gz	Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation
4	AFDB:P61022	0.926	0.931	9.861E-23	195	0.602	0.605	P61022.pdb.gz	CHP1_MOUSE Calcineurin B homologous protein 1 OS=Mus musculus OX=10090 GN=Chp1 PE=1 SV=2
5	PDB:2ct9B	0.847	0.838	4.483E-19	198	0.566	0.561	2ct9B.pdb.gz	Structural characterization of calcineurin B homologous protein 1
6	AFDB:Q7K107	0.875	0.740	9.909E-17	233	0.464	0.391	Q7K107.pdb.gz	Q7K107_DROME LD19356p (Fragment) OS=Drosophila melanogaster OX=7227 GN=elm PE=2 SV=1
7	AFDB:J9VL81	0.779	0.868	1.374E-14	175	0.362	0.406	J9VL81.pdb.gz	J9VL81_CRYNH Calcineurin subunit B OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_00888 PE=1 SV=1
8	PDB:6tz8B	0.759	0.848	5.207E-14	174	0.347	0.391	6tz8B.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
9	AFDB:Q55G87	0.788	0.853	5.501E-14	180	0.321	0.350	Q55G87.pdb.gz	CANB1_DICDI Calcineurin subunit B type 1 OS=Dictyostelium discoideum OX=44689 GN=cnbA PE=1 SV=1
10	AFDB:Q9UU93	0.774	0.868	2.998E-13	174	0.296	0.333	Q9UU93.pdb.gz	CANB_SCHPO Calcineurin subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnb1 PE=3 SV=1
11	AFDB:P48451	0.741	0.845	3.682E-13	170	0.327	0.376	P48451.pdb.gz	CANB1_DROME Calcineurin subunit B type 1 OS=Drosophila melanogaster OX=7227 GN=CanB PE=2 SV=1
12	AFDB:G5EDN6	0.740	0.841	1.029E-12	171	0.332	0.380	G5EDN6.pdb.gz	CANB_CAEEL Protein phosphatase 2B regulatory subunit cnb-1 OS=Caenorhabditis elegans OX=6239 GN=cnb-1 PE=1 SV=1
13	AFDB:P63098	0.733	0.835	1.140E-12	170	0.327	0.376	P63098.pdb.gz	CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens OX=9606 GN=PPP3R1 PE=1 SV=2
14	PDB:7u0tA	0.712	0.733	1.561E-11	190	0.311	0.321	7u0tA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
15	PDB:4il1A	0.632	0.247	9.121E-9	529	0.296	0.110	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
16	PDB:2zfdA	0.717	0.763	1.605E-8	183	0.235	0.251	2zfdA.pdb.gz	The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
17	PDB:6wu5B	0.677	0.722	6.764E-8	183	0.179	0.191	6wu5B.pdb.gz	CIB2 and CIB3 are auxiliary subunits of the mechanotransduction channel of hair cells.
18	PDB:1v1fA	0.715	0.743	1.190E-7	188	0.224	0.234	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
19	PDB:5x9aB	0.663	0.657	4.766E-7	198	0.184	0.182	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition
20	PDB:5aanA	0.687	0.731	5.017E-7	183	0.199	0.213	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43745	1.16e-143	399	196	1.000	1.000	CHP2_HUMAN Calcineurin B homologous protein 2 OS=Homo sapiens OX=9606 GN=CHP2 PE=1 SV=3
2	Q810D1	1.39e-117	333	196	0.816	0.816	CHP2_RAT Calcineurin B homologous protein 2 OS=Rattus norvegicus OX=10116 GN=Chp2 PE=1 SV=1
3	Q99653	3.14e-83	246	195	0.607	0.610	CHP1_HUMAN Calcineurin B homologous protein 1 OS=Homo sapiens OX=9606 GN=CHP1 PE=1 SV=3
4	P61022	3.09e-82	244	195	0.602	0.605	CHP1_MOUSE Calcineurin B homologous protein 1 OS=Mus musculus OX=10090 GN=Chp1 PE=1 SV=2
5	P61023	3.09e-82	244	195	0.602	0.605	CHP1_RAT Calcineurin B homologous protein 1 OS=Rattus norvegicus OX=10116 GN=Chp1 PE=1 SV=2
6	Q5ZM44	6.48e-79	235	195	0.602	0.605	CHP1_CHICK Calcineurin B homologous protein 1 OS=Gallus gallus OX=9031 GN=CHP1 PE=1 SV=3
7	Q9VNF9	1.07e-55	176	189	0.480	0.497	Q9VNF9_DROME Ethanol sensitive with low memory, isoform A OS=Drosophila melanogaster OX=7227 GN=elm PE=1 SV=1
8	Q7K107	2.81e-55	177	233	0.480	0.403	Q7K107_DROME LD19356p (Fragment) OS=Drosophila melanogaster OX=7227 GN=elm PE=2 SV=1
9	J9VL81	2.44e-35	124	175	0.352	0.394	J9VL81_CRYNH Calcineurin subunit B OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_00888 PE=1 SV=1
10	P25296	8.53e-33	117	175	0.327	0.366	CANB_YEAST Calcineurin subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CNB1 PE=1 SV=3
11	Q4QC21	2.74e-32	116	175	0.311	0.349	Q4QC21_LEIMA Putative calcineurin B subunit OS=Leishmania major OX=5664 GN=LMJF_21_1630 PE=3 SV=1
12	Q6FLU4	4.45e-32	115	175	0.316	0.354	CANB_CANGA Calcineurin subunit B OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CNB1 PE=3 SV=1
13	H9G2Y1	1.05e-31	114	170	0.321	0.371	H9G2Y1_CAEEL EF-hand domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cnb-1 PE=1 SV=1
14	Q38CK1	4.47e-31	113	179	0.301	0.330	Q38CK1_TRYB2 Calcineurin B subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7970 PE=4 SV=1
15	P63098	7.45e-31	112	170	0.311	0.359	CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens OX=9606 GN=PPP3R1 PE=1 SV=2
16	P63099	7.45e-31	112	170	0.311	0.359	CANB1_BOVIN Calcineurin subunit B type 1 OS=Bos taurus OX=9913 GN=PPP3R1 PE=1 SV=2
17	P63100	7.45e-31	112	170	0.311	0.359	CANB1_RAT Calcineurin subunit B type 1 OS=Rattus norvegicus OX=10116 GN=Ppp3r1 PE=1 SV=2
18	Q63810	7.45e-31	112	170	0.311	0.359	CANB1_MOUSE Calcineurin subunit B type 1 OS=Mus musculus OX=10090 GN=Ppp3r1 PE=1 SV=3
19	G5EDN6	1.13e-30	112	171	0.327	0.374	CANB_CAEEL Protein phosphatase 2B regulatory subunit cnb-1 OS=Caenorhabditis elegans OX=6239 GN=cnb-1 PE=1 SV=1
20	A0A1D8PP58	1.22e-29	109	173	0.296	0.335	A0A1D8PP58_CANAL Calcineurin subunit B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CNB1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16844 DIMCO_N	1.5e+02	14.1	Dinitrogenase iron-molybdenum cofactor, N-terminal
2	PF00404 Dockerin_1	16	17.1	Dockerin type I domain
3	PF00036 EF-hand_1	9.8e-14	60.9	EF hand
4	PF12763 EF-hand_4	1.4e+02	13.8	Cytoskeletal-regulatory complex EF hand
5	PF13202 EF-hand_5	9.9e-12	55.0	EF hand
6	PF13405 EF-hand_6	1.4e-13	60.5	EF-hand domain
7	PF13499 EF-hand_7	1.1e-14	65.9	EF-hand domain pair
8	PF13833 EF-hand_8	4.1e-08	44.2	EF-hand domain pair
9	PF14658 EF-hand_9	37	16.1	EF-hand domain
10	PF12174 RST	12	17.2	RCD1-SRO-TAF4 (RST) plant domain
11	PF10591 SPARC_Ca_bdg	0.0016	30.2	Secreted protein acidic and rich in cysteine Ca binding region
12	PF05099 TerB	71	15.2	Tellurite resistance protein TerB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300113

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263980	0.984	Sodium/hydrogen exchanger 1
2	9606.ENSP00000378323	0.557	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
3	9606.ENSP00000361524	0.517	Telomere length and silencing protein 1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005509	1.000	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.986	cellular process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0050896	0.962	response to stimulus
GO:0048518	0.955	positive regulation of biological process
GO:0048522	0.948	positive regulation of cellular process
GO:0019222	0.921	regulation of metabolic process
GO:0060255	0.875	regulation of macromolecule metabolic process
GO:0080090	0.874	regulation of primary metabolic process
GO:0051171	0.872	regulation of nitrogen compound metabolic process
GO:0031323	0.870	regulation of cellular metabolic process
GO:0010604	0.790	positive regulation of macromolecule metabolic process
GO:0051049	0.787	regulation of transport
GO:0051173	0.784	positive regulation of nitrogen compound metabolic process
GO:0023051	0.764	regulation of signaling
GO:0010646	0.764	regulation of cell communication
GO:0051716	0.754	cellular response to stimulus
GO:0050848	0.742	regulation of calcium-mediated signaling
GO:0106056	0.640	regulation of calcineurin-mediated signaling
GO:0051050	0.604	positive regulation of transport
GO:0019219	0.603	regulation of nucleobase-containing compound metabolic process
GO:0051223	0.538	regulation of protein transport
GO:0009889	0.515	regulation of biosynthetic process
GO:0065009	0.499	regulation of molecular function
GO:0045935	0.499	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.480	regulation of DNA-templated transcription
GO:0009891	0.474	positive regulation of biosynthetic process
GO:0070884	0.464	regulation of calcineurin-NFAT signaling cascade
GO:0007165	0.457	signal transduction
GO:0045893	0.457	positive regulation of DNA-templated transcription
GO:0044093	0.452	positive regulation of molecular function
GO:0045944	0.447	positive regulation of transcription by RNA polymerase II
GO:1902533	0.433	positive regulation of intracellular signal transduction
GO:0071704	0.375	organic substance metabolic process
GO:0044238	0.341	primary metabolic process
GO:1904951	0.341	positive regulation of establishment of protein localization
GO:0050790	0.340	regulation of catalytic activity
GO:0035556	0.333	intracellular signal transduction
GO:0043170	0.326	macromolecule metabolic process
GO:0048519	0.313	negative regulation of biological process
GO:0050850	0.308	positive regulation of calcium-mediated signaling
GO:0048523	0.301	negative regulation of cellular process
GO:0019220	0.301	regulation of phosphate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	0.999	cytoplasm
GO:0071944	0.997	cell periphery
GO:0005654	0.997	nucleoplasm
GO:0005886	0.992	plasma membrane
GO:0005829	0.992	cytosol
GO:0043232	0.984	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]