StarFunc result for job id O43765

User Input

>input (313 residues)
MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPE
IFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL
NPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVA
YYKKALELDPDNETYKSNLKIAELKLREAPSPTGGVGSFDIAGLLNNPGFMSMASNLMNN
PQIQQLMSGMISGGNNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIR
SRTPSASNDDQQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43765	1.000	1.000	3.645E-43	313	1.000	1.000	O43765.pdb.gz	SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1
2	AFDB:O70593	0.532	0.531	3.200E-37	314	0.888	0.885	O70593.pdb.gz	SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus OX=10116 GN=Sgta PE=1 SV=1
3	AFDB:Q80W98	0.448	0.461	1.832E-26	304	0.565	0.582	Q80W98.pdb.gz	SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Rattus norvegicus OX=10116 GN=Sgtb PE=1 SV=1
4	AFDB:Q21746	0.441	0.413	2.165E-19	337	0.422	0.392	Q21746.pdb.gz	Q21746_CAEEL SGTA homodimerisation domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sgt-1 PE=1 SV=1
5	AFDB:O13797	0.411	0.406	8.597E-17	317	0.319	0.315	O13797.pdb.gz	SGT2_SCHPO Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sgt2 PE=3 SV=1
6	AFDB:Q12118	0.396	0.359	1.799E-15	346	0.307	0.277	Q12118.pdb.gz	SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGT2 PE=1 SV=1
7	AFDB:Q54VG4	0.398	0.374	5.560E-15	334	0.329	0.308	Q54VG4.pdb.gz	SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=sgt PE=1 SV=1
8	AFDB:Q9VJD4	0.391	0.370	1.416E-13	331	0.310	0.293	Q9VJD4.pdb.gz	Q9VJD4_DROME LD24721p OS=Drosophila melanogaster OX=7227 GN=Sgt PE=1 SV=1
9	AFDB:Q585Z8	0.398	0.305	1.420E-12	416	0.319	0.240	Q585Z8.pdb.gz	Q585Z8_TRYB2 STI1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.320 PE=4 SV=1
10	AFDB:Q5XEP2	0.391	0.221	4.213E-9	571	0.192	0.105	Q5XEP2.pdb.gz	HSOP2_ARATH Hsp70-Hsp90 organizing protein 2 OS=Arabidopsis thaliana OX=3702 GN=HOP2 PE=1 SV=1
11	PDB:7kw7E	0.392	0.376	9.824E-9	327	0.179	0.171	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
12	PDB:7obeA	0.371	0.245	5.207E-8	480	0.160	0.104	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
13	PDB:2c2lA	0.400	0.443	7.731E-7	281	0.160	0.178	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
14	PDB:1ihgA	0.366	0.316	3.901E-6	364	0.118	0.102	1ihgA.pdb.gz
15	PDB:1wao1	0.367	0.247	5.776E-6	471	0.144	0.096	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
16	PDB:5njxA	0.379	0.289	6.066E-6	413	0.115	0.087	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
17	PDB:7dhgC	0.354	0.238	1.785E-5	470	0.102	0.068	7dhgC.pdb.gz
18	PDB:7qe7J	0.375	0.233	5.000E-5	510	0.115	0.071	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:3wxxG	0.356	0.704	6.389E-5	151	0.077	0.159	3wxxG.pdb.gz	Structure of AcrH-AopB Chaperone-Translocator Complex Reveals a Role for Membrane Hairpins in Type III Secretion System Translocon Assembly
20	PDB:2fi7A	0.366	0.506	9.460E-5	223	0.070	0.099	2fi7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43765	0.0	644	313	1.000	1.000	SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1
2	O70593	0.0	546	314	0.888	0.885	SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus OX=10116 GN=Sgta PE=1 SV=1
3	Q96EQ0	1.03e-107	317	304	0.581	0.599	SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens OX=9606 GN=SGTB PE=1 SV=1
4	Q80W98	2.31e-107	317	304	0.572	0.589	SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Rattus norvegicus OX=10116 GN=Sgtb PE=1 SV=1
5	Q21746	4.98e-67	214	337	0.406	0.377	Q21746_CAEEL SGTA homodimerisation domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sgt-1 PE=1 SV=1
6	O13797	6.79e-41	146	317	0.316	0.312	SGT2_SCHPO Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sgt2 PE=3 SV=1
7	Q54VG4	1.04e-38	141	334	0.339	0.317	SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=sgt PE=1 SV=1
8	Q585Z8	1.59e-37	140	416	0.252	0.190	Q585Z8_TRYB2 STI1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.320 PE=4 SV=1
9	Q9VJD4	3.22e-33	126	331	0.300	0.284	Q9VJD4_DROME LD24721p OS=Drosophila melanogaster OX=7227 GN=Sgt PE=1 SV=1
10	Q12118	1.85e-32	125	346	0.326	0.295	SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGT2 PE=1 SV=1
11	Q9LNB6	2.10e-21	96.7	572	0.188	0.103	HSOP1_ARATH Hsp70-Hsp90 organizing protein 1 OS=Arabidopsis thaliana OX=3702 GN=HOP1 PE=2 SV=1
12	F4KCL7	3.10e-21	96.3	603	0.169	0.088	OE64M_ARATH Outer envelope protein 64, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OM64 PE=1 SV=1
13	Q43468	2.47e-20	93.6	572	0.169	0.093	HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max OX=3847 GN=HOP1 PE=1 SV=2
14	Q5XEP2	5.18e-20	92.4	571	0.182	0.100	HSOP2_ARATH Hsp70-Hsp90 organizing protein 2 OS=Arabidopsis thaliana OX=3702 GN=HOP2 PE=1 SV=1
15	Q84XU2	3.86e-19	89.7	538	0.160	0.093	PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana OX=3702 GN=PAPP5 PE=1 SV=1
16	Q9STH1	1.61e-18	88.2	558	0.141	0.079	HSOP3_ARATH Hsp70-Hsp90 organizing protein 3 OS=Arabidopsis thaliana OX=3702 GN=HOP3 PE=2 SV=1
17	P53042	5.33e-18	86.3	499	0.144	0.090	PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus OX=10116 GN=Ppp5c PE=1 SV=1
18	Q60676	1.09e-17	85.5	499	0.141	0.088	PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus OX=10090 GN=Ppp5c PE=1 SV=3
19	Q6FRI9	2.12e-17	84.7	583	0.166	0.089	Q6FRI9_CANGA Candida glabrata strain CBS138 chromosome H complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0H08195g PE=4 SV=1
20	P53041	3.47e-17	84.0	499	0.141	0.088	PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03704 BTAD	34	16.3	Bacterial transcriptional activator domain
2	PF04781 DUF627	10	17.5	Protein of unknown function (DUF627)
3	PF14853 Fis1_TPR_C	99	14.6	Fis1 C-terminal tetratricopeptide repeat
4	PF12569 NatA_aux_su	6.4	17.2	N-terminal acetyltransferase A, auxiliary subunit
5	PF16546 SGTA_dimer	2.1e-18	77.2	Homodimerisation domain of SGTA
6	PF06552 TOM20_plant	0.6	21.4	Plant specific mitochondrial import receptor subunit TOM20
7	PF00515 TPR_1	3.8e-22	88.3	Tetratricopeptide repeat
8	PF13374 TPR_10	7.8e-05	33.6	Tetratricopeptide repeat
9	PF13414 TPR_11	4.5e-11	53.6	TPR repeat
10	PF13424 TPR_12	0.00097	30.7	Tetratricopeptide repeat
11	PF13428 TPR_14	5.7e-05	34.6	Tetratricopeptide repeat
12	PF13429 TPR_15	1.1e+02	13.6	Tetratricopeptide repeat
13	PF13432 TPR_16	0.00072	31.4	Tetratricopeptide repeat
14	PF13431 TPR_17	2.4e-08	44.8	Tetratricopeptide repeat
15	PF14559 TPR_19	0.00067	31.4	Tetratricopeptide repeat
16	PF07719 TPR_2	1.9e-14	63.6	Tetratricopeptide repeat
17	PF13174 TPR_6	23	17.0	Tetratricopeptide repeat
18	PF13176 TPR_7	4.9e-08	43.5	Tetratricopeptide repeat
19	PF13181 TPR_8	5.6e-14	62.1	Tetratricopeptide repeat
20	PF13371 TPR_9	0.82	21.1	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000221566

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358674	0.998	Ubiquitin-like protein 4A
2	9606.ENSP00000432083	0.997	Heat shock cognate 71 kDa protein
3	9606.ENSP00000265857	0.995	Golgi to ER traffic protein 4 homolog
4	9606.ENSP00000302961	0.995	Heat shock protein family A member 4
5	9606.ENSP00000466379	0.995	ATPase ASNA1
6	9606.ENSP00000365131	0.982	Large proline-rich protein BAG6
7	9606.ENSP00000318687	0.978	Heat shock protein 105 kDa
8	9606.ENSP00000335153	0.970	Heat shock protein HSP 90-alpha
9	9606.ENSP00000327716	0.943	Tail-anchored protein insertion receptor WRB
10	9606.ENSP00000297156	0.889	Calcium signal-modulating cyclophilin ligand
11	9606.ENSP00000223641	0.886	Protein transport protein Sec61 subunit beta
12	9606.ENSP00000478877	0.844	Proteasomal ubiquitin receptor ADRM1
13	9606.ENSP00000314030	0.838	DnaJ homolog subfamily A member 2
14	9606.ENSP00000345575	0.832	DnaJ homolog subfamily B member 12
15	9606.ENSP00000292363	0.820	E3 ubiquitin-protein ligase RNF126
16	9606.ENSP00000404381	0.818	DnaJ homolog subfamily B member 14
17	9606.ENSP00000314214	0.786	Vesicle-associated membrane protein 2
18	9606.ENSP00000420076	0.783	Stress-associated endoplasmic reticulum protein 1
19	9606.ENSP00000369127	0.776	DnaJ homolog subfamily A member 1
20	9606.ENSP00000337632	0.742	SAP domain-containing ribonucleoprotein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043621	0.904	protein self-association
GO:0044877	0.858	protein-containing complex binding
GO:0042802	0.849	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.891	biological regulation
GO:0050789	0.882	regulation of biological process
GO:0050794	0.749	regulation of cellular process
GO:0008152	0.661	metabolic process
GO:0071704	0.607	organic substance metabolic process
GO:0044238	0.580	primary metabolic process
GO:0050896	0.577	response to stimulus
GO:0044237	0.552	cellular metabolic process
GO:0006807	0.544	nitrogen compound metabolic process
GO:0071840	0.538	cellular component organization or biogenesis
GO:0016043	0.487	cellular component organization
GO:0043170	0.482	macromolecule metabolic process
GO:0019222	0.470	regulation of metabolic process
GO:1901564	0.460	organonitrogen compound metabolic process
GO:0051716	0.456	cellular response to stimulus
GO:0048518	0.450	positive regulation of biological process
GO:0051179	0.442	localization
GO:0019538	0.438	protein metabolic process
GO:0080090	0.422	regulation of primary metabolic process
GO:0060255	0.422	regulation of macromolecule metabolic process
GO:0048522	0.419	positive regulation of cellular process
GO:0051171	0.415	regulation of nitrogen compound metabolic process
GO:0048519	0.410	negative regulation of biological process
GO:0031323	0.410	regulation of cellular metabolic process
GO:0006950	0.336	response to stress
GO:0048523	0.331	negative regulation of cellular process
GO:0051641	0.327	cellular localization
GO:0051234	0.321	establishment of localization
GO:0008104	0.318	protein localization
GO:0042221	0.316	response to chemical
GO:0006457	0.313	protein folding
GO:1901575	0.305	organic substance catabolic process
GO:0051603	0.302	proteolysis involved in protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0016020	0.998	membrane
GO:0005634	0.959	nucleus
GO:0032991	0.921	protein-containing complex
GO:0043233	0.570	organelle lumen
GO:0012505	0.558	endomembrane system
GO:0070013	0.522	intracellular organelle lumen
GO:0031090	0.460	organelle membrane
GO:0031982	0.355	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]