StarFunc result for job id O43766

User Input

>input (372 residues)
MSLRCGDAARTLGPRVFGRYFCSPVRPLSSLPDKKKELLQNGPDLQDFVSGDLADRSTWD
EYKGNLKRQKGERLRLPPWLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGG
GEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDASEPYNTAKAIAEWGLDYVVLTSV
DRDDMPDGGAEHIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVET
VPELQSKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREAD
VDCLTLGQYMQPTRRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFL
KNLVAKRKTKDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99M04	0.921	0.919	9.732E-68	373	0.903	0.901	Q99M04.pdb.gz	LIAS_MOUSE Lipoyl synthase, mitochondrial OS=Mus musculus OX=10090 GN=Lias PE=1 SV=1
2	AFDB:Q9ZWT1	0.809	0.805	5.173E-47	374	0.522	0.519	Q9ZWT1.pdb.gz	LIAS_ARATH Lipoyl synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LIP1 PE=1 SV=1
3	AFDB:O13642	0.812	0.817	8.739E-47	370	0.567	0.570	O13642.pdb.gz	LIPA_SCHPO Lipoyl synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lip5 PE=3 SV=2
4	AFDB:P32875	0.788	0.709	9.246E-45	414	0.535	0.481	P32875.pdb.gz	LIPA_YEAST Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LIP5 PE=1 SV=1
5	AFDB:Q8IDQ0	0.789	0.708	4.861E-43	415	0.492	0.441	Q8IDQ0.pdb.gz	LIPA_PLAF7 Lipoyl synthase, apicoplast OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=lipA PE=2 SV=1
6	AFDB:Q388A7	0.808	0.737	2.792E-42	409	0.473	0.430	Q388A7.pdb.gz	LIPA_TRYB2 Lipoyl synthase, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1530 PE=3 SV=1
7	AFDB:O32129	0.753	0.936	1.640E-34	298	0.347	0.433	O32129.pdb.gz	LIPA_BACSU Lipoyl synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=lipA PE=1 SV=2
8	AFDB:P60716	0.737	0.851	9.122E-31	321	0.339	0.393	P60716.pdb.gz	LIPA_ECOLI Lipoyl synthase OS=Escherichia coli (strain K12) OX=83333 GN=lipA PE=1 SV=1
9	AFDB:P9WPQ7	0.446	0.472	1.096E-9	349	0.172	0.183	P9WPQ7.pdb.gz	BIOB_MYCTU Biotin synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=bioB PE=1 SV=1
10	AFDB:Q727U8	0.455	0.455	2.952E-9	372	0.126	0.126	Q727U8.pdb.gz	Q727U8_DESVH Aminodeoxyfutalosine synthase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=mqnE PE=1 SV=1
11	PDB:3t7vA	0.461	0.504	7.763E-9	337	0.121	0.134	3t7vA.pdb.gz	Crystal structure of methylornithine synthase (PylB): insights into the pyrrolysine biosynthesis.
12	PDB:1r30B	0.398	0.457	4.206E-8	313	0.097	0.115	1r30B.pdb.gz	Crystal structure of biotin synthase, an S-adenosylmethionine-dependent radical enzyme.
13	PDB:1oltA	0.402	0.352	2.872E-5	434	0.086	0.074	1oltA.pdb.gz	Crystal Structure of Coproporphyrinogen III Oxidase Reveals Cofactor Geometry of Radical Sam Enzymes
14	PDB:1gthA	0.331	0.136	3.227E-5	1019	0.102	0.037	1gthA.pdb.gz	Crystal structure of the productive ternary complex of dihydropyrimidine dehydrogenase with NADPH and 5-iodouracil. Implications for mechanism of inhibition and electron transfer.
15	PDB:4hnvB	0.260	0.123	5.143E-5	1033	0.148	0.053	4hnvB.pdb.gz	Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.
16	PDB:3bg5A	0.255	0.110	1.748E-4	1137	0.094	0.031	3bg5A.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
17	PDB:3bg5B	0.268	0.125	1.748E-4	1074	0.148	0.051	3bg5B.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
18	PDB:1m3uA	0.253	0.342	1.853E-4	262	0.078	0.111	1m3uA.pdb.gz	Structure of E. coli Ketopantoate Hydroxymethyl Transferase Complexed with Ketopantoate and Mg(2+), Solved by Locating 160 Selenomethionine Sites.
19	PDB:3ho8D	0.266	0.137	2.787E-4	934	0.145	0.058	3ho8D.pdb.gz	A Symmetrical Tetramer for S. aureus Pyruvate Carboxylase in Complex with Coenzyme A.
20	PDB:1ps9A	0.341	0.210	3.518E-4	671	0.097	0.054	1ps9A.pdb.gz	The crystal structure and reaction mechanism of Escherichia coli 2,4-dienoyl-CoA reductase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43766	0.0	773	372	1.000	1.000	LIAS_HUMAN Lipoyl synthase, mitochondrial OS=Homo sapiens OX=9606 GN=LIAS PE=1 SV=3
2	Q99M04	0.0	701	373	0.903	0.901	LIAS_MOUSE Lipoyl synthase, mitochondrial OS=Mus musculus OX=10090 GN=Lias PE=1 SV=1
3	O13642	6.68e-147	422	370	0.548	0.551	LIPA_SCHPO Lipoyl synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lip5 PE=3 SV=2
4	P32875	3.59e-137	399	414	0.530	0.476	LIPA_YEAST Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LIP5 PE=1 SV=1
5	Q8IDQ0	8.58e-133	387	415	0.476	0.427	LIPA_PLAF7 Lipoyl synthase, apicoplast OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=lipA PE=2 SV=1
6	Q9ZWT1	2.71e-126	369	374	0.503	0.500	LIAS_ARATH Lipoyl synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LIP1 PE=1 SV=1
7	Q388A7	5.59e-116	345	409	0.460	0.418	LIPA_TRYB2 Lipoyl synthase, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1530 PE=3 SV=1
8	O32129	1.24e-83	258	298	0.344	0.430	LIPA_BACSU Lipoyl synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=lipA PE=1 SV=2
9	P60716	2.64e-81	253	321	0.333	0.386	LIPA_ECOLI Lipoyl synthase OS=Escherichia coli (strain K12) OX=83333 GN=lipA PE=1 SV=1
10	P32451	0.045	38.1	375	0.105	0.104	BIOB_YEAST Biotin synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BIO2 PE=1 SV=2
11	P54967	0.057	37.7	378	0.108	0.106	BIOB_ARATH Biotin synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BIO2 PE=1 SV=1
12	O59778	0.17	36.2	363	0.108	0.110	BIOB_SCHPO Biotin synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bio2 PE=1 SV=1
13	Q5AYI7	0.62	34.3	393	0.054	0.051	BIOB_EMENI Biotin synthase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bioB PE=2 SV=1
14	P22146	1.4	33.5	559	0.059	0.039	GAS1_YEAST 1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS1 PE=1 SV=2
15	Q01279	1.6	33.5	1210	0.038	0.012	EGFR_MOUSE Epidermal growth factor receptor OS=Mus musculus OX=10090 GN=Egfr PE=1 SV=1
16	Q9ESE0	2.1	32.7	478	0.038	0.029	Q9ESE0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Egfr PE=2 SV=2
17	Q72AA4	2.2	32.7	444	0.097	0.081	Q72AA4_DESVH ThiH protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=thiH PE=1 SV=1
18	Q504U8	2.8	32.7	1091	0.054	0.018	Q504U8_HUMAN Receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EGFR PE=1 SV=1
19	E7CXR8	3.7	32.3	1209	0.038	0.012	E7CXR8_RAT Receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Egfr PE=2 SV=1
20	E7CXR9	3.7	32.3	1209	0.038	0.012	E7CXR9_RAT Receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Egfr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16881 LIAS_N	6.8e-48	173.0	N-terminal domain of lipoyl synthase of Radical_SAM family
2	PF04055 Radical_SAM	1.6e-12	59.6	Radical SAM superfamily
3	PF05443 ROS_MUCR	2.9e+02	12.9	ROS/MUCR transcriptional regulator protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261434

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309463	0.994	Putative lipoyltransferase 2, mitochondrial
2	9606.ENSP00000377115	0.991	Lipoyltransferase 1, mitochondrial
3	9606.ENSP00000319531	0.977	Glycine cleavage system H protein, mitochondrial
4	9606.ENSP00000387219	0.950	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
5	9606.ENSP00000331369	0.938	BolA-like protein 3
6	9606.ENSP00000452007	0.934	Iron-sulfur cluster assembly 2 homolog, mitochondrial
7	9606.ENSP00000355672	0.925	Putative transferase CAF17, mitochondrial
8	9606.ENSP00000365159	0.916	Iron-sulfur cluster assembly 1 homolog, mitochondrial
9	9606.ENSP00000215941	0.908	Ankyrin repeat domain-containing protein 54
10	9606.ENSP00000328570	0.881	Glutaredoxin-related protein 5, mitochondrial
11	9606.ENSP00000310623	0.879	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
12	9606.ENSP00000358149	0.872	BolA-like protein 1
13	9606.ENSP00000377311	0.844	Ferredoxin-2, mitochondrial
14	9606.ENSP00000216027	0.836	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
15	9606.ENSP00000420026	0.822	LYR motif-containing protein 4
16	9606.ENSP00000363205	0.809	Cysteine desulfurase, mitochondrial
17	9606.ENSP00000205402	0.802	Dihydrolipoyl dehydrogenase, mitochondrial
18	9606.ENSP00000372326	0.769	Ferrochelatase, mitochondrial
19	9606.ENSP00000296577	0.764	ATP-binding cassette sub-family E member 1
20	9606.ENSP00000357633	0.763	Glutaredoxin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016992	1.000	lipoate synthase activity
GO:0005488	0.960	binding
GO:0005515	0.718	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.996	metabolic process
GO:0071704	0.994	organic substance metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0044238	0.989	primary metabolic process
GO:0019752	0.885	carboxylic acid metabolic process
GO:0006629	0.865	lipid metabolic process
GO:0044283	0.779	small molecule biosynthetic process
GO:0006790	0.777	sulfur compound metabolic process
GO:0044249	0.751	cellular biosynthetic process
GO:0006807	0.625	nitrogen compound metabolic process
GO:1901576	0.615	organic substance biosynthetic process
GO:1901564	0.580	organonitrogen compound metabolic process
GO:1901360	0.577	organic cyclic compound metabolic process
GO:0046483	0.562	heterocycle metabolic process
GO:0032787	0.388	monocarboxylic acid metabolic process
GO:1901362	0.324	organic cyclic compound biosynthetic process
GO:0072330	0.323	monocarboxylic acid biosynthetic process
GO:0044272	0.312	sulfur compound biosynthetic process
GO:0050896	0.307	response to stimulus
GO:0018130	0.305	heterocycle biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.959	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16585	1.000	[[Fe-S] cluster scaffold protein carrying a second [4Fe-4S](2+) cluster] + 4 H(+) + N(6)-octanoyl-L-lysyl-[protein] + 2 oxidized [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = (R)-N(6)-dihydrolipoyl-L-lysyl-[protein] + 2 5'-deoxyadenosine + [[Fe-S] cluster scaffold protein] + 4 Fe(3+) + 2 hydrogen sulfide + 2 L-methionine + 2 reduced [2Fe-2S]-[ferredoxin]
EC:2.8.1.8	1.000	lipoyl synthase.

[back to server]