StarFunc result for job id O43776

User Input

>input (548 residues)
MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISK
SQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGAL
EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVA
VYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGE
NMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSS
QLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCD
VVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIP
EAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIF
DSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYP
RFVQRCTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BP47	0.998	0.978	0.000	559	0.936	0.918	Q8BP47.pdb.gz	SYNC_MOUSE Asparagine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=NARS1 PE=1 SV=2
2	AFDB:Q9V434	0.936	0.920	1.868E-95	558	0.719	0.706	Q9V434.pdb.gz	Q9V434_DROME asparagine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=AsnRS PE=1 SV=1
3	AFDB:Q19722	0.962	0.967	3.980E-85	545	0.580	0.583	Q19722.pdb.gz	SYNC_CAEEL Asparagine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=nars-1 PE=3 SV=1
4	AFDB:O94567	0.868	0.838	4.386E-78	568	0.500	0.482	O94567.pdb.gz	SYNC_SCHPO Probable asparagine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nrs1 PE=3 SV=1
5	AFDB:P38707	0.826	0.817	1.819E-77	554	0.520	0.514	P38707.pdb.gz	SYNC_YEAST Asparagine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DED81 PE=1 SV=1
6	AFDB:Q554D9	0.806	0.678	1.651E-67	653	0.474	0.398	Q554D9.pdb.gz	SYNC_DICDI Asparagine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=asnS1 PE=1 SV=1
7	AFDB:Q584F6	0.744	0.549	1.033E-58	746	0.385	0.283	Q584F6.pdb.gz	Q584F6_TRYB2 asparagine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.630 PE=4 SV=1
8	AFDB:Q97PR0	0.731	0.888	3.577E-47	447	0.281	0.345	Q97PR0.pdb.gz	SYN_STRPN Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=asnS PE=1 SV=1
9	AFDB:P54263	0.724	0.898	2.209E-46	438	0.259	0.324	P54263.pdb.gz	SYN_THET8 Asparagine--tRNA ligase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=asnS PE=1 SV=2
10	AFDB:Q96I59	0.713	0.815	9.224E-42	477	0.261	0.300	Q96I59.pdb.gz	SYNM_HUMAN Probable asparagine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=NARS2 PE=1 SV=3
11	PDB:5zg8A	0.693	0.891	2.612E-41	422	0.241	0.313	5zg8A.pdb.gz
12	PDB:4j15A	0.627	0.783	1.131E-31	431	0.188	0.239	4j15A.pdb.gz
13	PDB:1e1tA	0.596	0.668	2.451E-28	485	0.181	0.204	1e1tA.pdb.gz	Active Site of Lysyl-tRNA Synthetase: Structural Studies of the Adenylation Reaction
14	PDB:1bbuA	0.600	0.671	6.092E-28	486	0.177	0.200	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.
15	PDB:6chdA	0.610	0.657	2.674E-27	506	0.170	0.184	6chdA.pdb.gz	Crystal Structure of Human Lysyl-tRNA Synthetase complexed with L-Lysylsulfamoyl Adenosine
16	PDB:5w25A	0.607	0.572	1.080E-25	583	0.195	0.184	5w25A.pdb.gz	Crystal structure of Aspartyl-tRNA synthetase from Mycobacterium tuberculosis complexed with L-Aspartic Acid
17	PDB:1eqrA	0.615	0.574	5.622E-25	590	0.177	0.164	1eqrA.pdb.gz
18	PDB:4ah6A	0.596	0.557	2.850E-23	589	0.190	0.177	4ah6A.pdb.gz
19	PDB:3a5zC	0.414	0.666	2.427E-17	324	0.119	0.201	3a5zC.pdb.gz	A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.
20	PDB:3a5yA	0.387	0.685	1.882E-16	297	0.117	0.215	3a5yA.pdb.gz	A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43776	0.0	1143	548	1.000	1.000	SYNC_HUMAN Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=NARS1 PE=1 SV=1
2	O94567	0.0	536	568	0.498	0.481	SYNC_SCHPO Probable asparagine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nrs1 PE=3 SV=1
3	P38707	0.0	573	554	0.526	0.520	SYNC_YEAST Asparagine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DED81 PE=1 SV=1
4	Q19722	0.0	654	545	0.584	0.587	SYNC_CAEEL Asparagine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=nars-1 PE=3 SV=1
5	Q8BP47	0.0	1083	559	0.936	0.918	SYNC_MOUSE Asparagine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=NARS1 PE=1 SV=2
6	Q9V434	0.0	824	558	0.719	0.706	Q9V434_DROME asparagine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=AsnRS PE=1 SV=1
7	Q554D9	1.07e-178	520	653	0.491	0.412	SYNC_DICDI Asparagine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=asnS1 PE=1 SV=1
8	Q584F6	1.27e-138	421	746	0.400	0.294	Q584F6_TRYB2 asparagine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.630 PE=4 SV=1
9	Q97PR0	2.65e-70	234	447	0.288	0.353	SYN_STRPN Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=asnS PE=1 SV=1
10	P54263	1.69e-69	232	438	0.255	0.320	SYN_THET8 Asparagine--tRNA ligase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=asnS PE=1 SV=2
11	Q8BGV0	3.84e-53	189	477	0.261	0.300	SYNM_MOUSE Probable asparagine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Nars2 PE=1 SV=1
12	Q96I59	5.31e-52	186	477	0.265	0.304	SYNM_HUMAN Probable asparagine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=NARS2 PE=1 SV=3
13	P0A8M0	4.03e-50	181	466	0.234	0.275	SYN_ECOLI Asparagine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=asnS PE=1 SV=2
14	Q9P6I0	2.46e-48	175	441	0.245	0.304	SYNM_SCHPO Asparagine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slm5 PE=3 SV=1
15	O48593	8.08e-45	168	567	0.252	0.243	SYNO_ARATH Asparagine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SYNO PE=2 SV=3
16	O51128	2.09e-44	165	462	0.215	0.255	SYN_BORBU Asparagine--tRNA ligase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=asnS PE=3 SV=2
17	P15178	8.28e-42	159	501	0.182	0.200	SYDC_RAT Aspartate--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Dars1 PE=1 SV=1
18	Q922B2	2.33e-41	157	501	0.181	0.198	SYDC_MOUSE Aspartate--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Dars1 PE=1 SV=2
19	Q9SW96	1.29e-40	157	572	0.177	0.170	SYNC1_ARATH Asparagine--tRNA ligase, cytoplasmic 1 OS=Arabidopsis thaliana OX=3702 GN=SYNC1 PE=1 SV=1
20	Q585M3	2.10e-40	156	560	0.246	0.241	Q585M3_TRYB2 aspartate--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.1030 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00152 tRNA-synt_2	6.9e-105	362.2	tRNA synthetases class II (D, K and N)
2	PF01336 tRNA_anti-codon	5.9e-07	40.7	OB-fold nucleic acid binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256854

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355890	0.996	Bifunctional glutamate/proline--tRNA ligase
2	9606.ENSP00000364794	0.990	Isoleucine--tRNA ligase, cytoplasmic
3	9606.ENSP00000261772	0.989	Alanine--tRNA ligase, cytoplasmic
4	9606.ENSP00000377954	0.984	Leucine--tRNA ligase, cytoplasmic
5	9606.ENSP00000263985	0.981	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
6	9606.ENSP00000325448	0.972	Lysine--tRNA ligase
7	9606.ENSP00000373918	0.972	Glycine--tRNA ligase
8	9606.ENSP00000358042	0.965	Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
9	9606.ENSP00000362576	0.963	Tyrosine--tRNA ligase, cytoplasmic
10	9606.ENSP00000387710	0.948	Threonine--tRNA ligase, cytoplasmic
11	9606.ENSP00000307567	0.939	Glutamine--tRNA ligase
12	9606.ENSP00000231572	0.937	Arginine--tRNA ligase, cytoplasmic
13	9606.ENSP00000234677	0.915	Serine--tRNA ligase, cytoplasmic
14	9606.ENSP00000320309	0.908	phenylalanyl-tRNA synthetase alpha subunit
15	9606.ENSP00000355889	0.904	Isoleucine--tRNA ligase, mitochondrial
16	9606.ENSP00000338093	0.900	Probable threonine--tRNA ligase 2, cytoplasmic
17	9606.ENSP00000446872	0.900	Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
18	9606.ENSP00000369897	0.893	Cysteine--tRNA ligase, cytoplasmic
19	9606.ENSP00000358549	0.891	Probable arginine--tRNA ligase, mitochondrial
20	9606.ENSP00000425634	0.890	Histidine--tRNA ligase, cytoplasmic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004812	0.999	aminoacyl-tRNA ligase activity
GO:0005515	0.998	protein binding
GO:0005126	0.990	cytokine receptor binding
GO:0004816	0.953	asparagine-tRNA ligase activity
GO:0003676	0.846	nucleic acid binding
GO:0001664	0.795	G protein-coupled receptor binding
GO:0042379	0.721	chemokine receptor binding
GO:0048020	0.661	CCR chemokine receptor binding
GO:0003723	0.511	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006412	0.998	translation
GO:1901360	0.995	organic cyclic compound metabolic process
GO:0046483	0.995	heterocycle metabolic process
GO:0006725	0.995	cellular aromatic compound metabolic process
GO:0044281	0.991	small molecule metabolic process
GO:0090304	0.988	nucleic acid metabolic process
GO:0019752	0.984	carboxylic acid metabolic process
GO:0016070	0.981	RNA metabolic process
GO:0006520	0.964	amino acid metabolic process
GO:0006399	0.957	tRNA metabolic process
GO:0006418	0.951	tRNA aminoacylation for protein translation
GO:0032501	0.719	multicellular organismal process
GO:0032502	0.708	developmental process
GO:0048856	0.703	anatomical structure development
GO:0007275	0.680	multicellular organism development
GO:0007399	0.632	nervous system development
GO:0007417	0.618	central nervous system development
GO:0060322	0.601	head development
GO:0007420	0.584	brain development
GO:0021537	0.430	telencephalon development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0005829	0.977	cytosol
GO:0005576	0.957	extracellular region
GO:0031982	0.949	vesicle
GO:0005739	0.942	mitochondrion
GO:0005615	0.921	extracellular space
GO:1903561	0.917	extracellular vesicle
GO:0070062	0.892	extracellular exosome
GO:0070013	0.497	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.1.1.-	0.999	Ligases forming aminoacyl-tRNA and related compounds.
RHEA:11180	0.953	ATP + L-asparagine + tRNA(Asn) = AMP + diphosphate + H(+) + L-asparaginyl-tRNA(Asn)
EC:6.1.1.22	0.953	asparagine--tRNA ligase.

[back to server]