StarFunc result for job id O43781

User Input

>input (588 residues)
MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPR
RLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
SDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHG
VIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMV
RNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIK
KNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSC
FEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLAC
MMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGS
KDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKR
VVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43781	1.000	1.000	3.676E-101	588	1.000	1.000	O43781.pdb.gz	DYRK3_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Homo sapiens OX=9606 GN=DYRK3 PE=1 SV=3
2	AFDB:Q922Y0	0.768	0.771	2.689E-90	586	0.896	0.899	Q922Y0.pdb.gz	DYRK3_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus OX=10090 GN=Dyrk3 PE=1 SV=1
3	PDB:5y86A	0.654	0.970	1.080E-70	395	0.672	1.000	5y86A.pdb.gz	Crystal Structure of Human Dual-Specificity Tyrosine-Regulated Kinase 3 Reveals New Structural Features and Insights into its Auto-phosphorylation
4	AFDB:P49657	0.534	0.350	7.034E-38	908	0.304	0.197	P49657.pdb.gz	MNB_DROME Serine/threonine-protein kinase minibrain OS=Drosophila melanogaster OX=7227 GN=mnb PE=1 SV=2
5	AFDB:A1L1U2	0.532	0.426	1.942E-37	737	0.287	0.229	A1L1U2.pdb.gz	A1L1U2_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=dyrk1a PE=2 SV=1
6	AFDB:Q13627	0.525	0.408	6.295E-37	763	0.282	0.218	Q13627.pdb.gz	DYR1A_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2
7	AFDB:Q07538	0.517	0.633	3.425E-32	477	0.228	0.281	Q07538.pdb.gz	PRP4_SCHPO Serine/threonine-protein kinase prp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp4 PE=1 SV=2
8	AFDB:F4HQ88	0.507	0.263	2.906E-31	1169	0.224	0.113	F4HQ88.pdb.gz	F4HQ88_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=DYRKP-2A PE=1 SV=1
9	AFDB:H7BXX9	0.484	0.318	2.743E-30	911	0.248	0.160	H7BXX9.pdb.gz	H7BXX9_HUMAN Homeodomain interacting protein kinase 2 OS=Homo sapiens OX=9606 GN=HIPK2 PE=1 SV=2
10	AFDB:Q26798	0.503	0.575	1.364E-29	512	0.197	0.227	Q26798.pdb.gz	Q26798_9TRYP Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase TbPK4 OS=Trypanosoma brucei OX=5691 PE=2 SV=2
11	AFDB:Q8IIL5	0.521	0.441	1.982E-29	699	0.218	0.183	Q8IIL5.pdb.gz	Q8IIL5_PLAF7 non-specific serine/threonine protein kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1114700 PE=3 SV=2
12	PDB:6khdB	0.478	0.834	7.673E-27	332	0.199	0.352	6khdB.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
13	PDB:6qx9K	0.471	0.843	1.622E-26	322	0.168	0.307	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
14	PDB:6kheA	0.482	0.814	3.080E-26	342	0.180	0.310	6kheA.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
15	PDB:6fadC	0.468	0.741	1.172E-25	359	0.190	0.312	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
16	PDB:4krcA	0.418	0.806	2.581E-22	297	0.163	0.323	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:1unlA	0.439	0.849	3.372E-22	292	0.146	0.295	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
18	PDB:4yc3A	0.417	0.810	3.925E-20	295	0.153	0.305	4yc3A.pdb.gz
19	PDB:4eomC	0.410	0.848	6.699E-20	276	0.145	0.308	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:7opmA	0.431	0.687	9.232E-20	362	0.162	0.262	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9JRD5	0.0	728	581	0.631	0.639	A9JRD5_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=dyrk2 PE=2 SV=1
2	O43781	0.0	1222	588	1.000	1.000	DYRK3_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Homo sapiens OX=9606 GN=DYRK3 PE=1 SV=3
3	Q5U4C9	0.0	712	599	0.602	0.591	DYRK2_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Mus musculus OX=10090 GN=Dyrk2 PE=2 SV=1
4	Q922Y0	0.0	1088	586	0.896	0.899	DYRK3_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus OX=10090 GN=Dyrk3 PE=1 SV=1
5	Q92630	0.0	704	601	0.592	0.579	DYRK2_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens OX=9606 GN=DYRK2 PE=1 SV=3
6	Q9XTF3	0.0	579	817	0.444	0.319	MBK2_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis elegans OX=6239 GN=mbk-2 PE=1 SV=1
7	Q5SY34	5.05e-176	499	243	0.403	0.975	Q5SY34_HUMAN Dual specificity tyrosine phosphorylation regulated kinase 3 (Fragment) OS=Homo sapiens OX=9606 GN=DYRK3 PE=1 SV=1
8	Q9NR20	4.51e-145	431	520	0.367	0.415	DYRK4_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Homo sapiens OX=9606 GN=DYRK4 PE=1 SV=2
9	A0A0A0MTH5	6.02e-144	432	634	0.367	0.341	A0A0A0MTH5_HUMAN dual-specificity kinase OS=Homo sapiens OX=9606 GN=DYRK4 PE=1 SV=1
10	Q9V3D5	8.35e-135	411	722	0.337	0.274	DYRK2_DROME Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Drosophila melanogaster OX=7227 GN=Dyrk2 PE=1 SV=1
11	Q09690	1.84e-108	352	1087	0.308	0.167	POM1_SCHPO DYRK-family kinase pom1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pom1 PE=1 SV=1
12	Q09815	7.35e-100	323	836	0.286	0.201	PPK5_SCHPO Serine/threonine-protein kinase ppk5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk5 PE=1 SV=1
13	Q9Z188	6.15e-87	284	629	0.257	0.240	DYR1B_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Mus musculus OX=10090 GN=Dyrk1b PE=1 SV=3
14	Q9Y463	3.73e-86	282	629	0.255	0.238	DYR1B_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Homo sapiens OX=9606 GN=DYRK1B PE=1 SV=1
15	A1L1U2	5.32e-85	282	737	0.276	0.220	A1L1U2_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=dyrk1a PE=2 SV=1
16	P49657	1.24e-84	284	908	0.255	0.165	MNB_DROME Serine/threonine-protein kinase minibrain OS=Drosophila melanogaster OX=7227 GN=mnb PE=1 SV=2
17	A0A0R4II39	6.24e-84	278	681	0.250	0.216	A0A0R4II39_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=si:ch211-225p5.1 PE=3 SV=1
18	D1L3Y5	1.46e-83	278	751	0.245	0.192	D1L3Y5_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=si:ch211-225p5.1 PE=2 SV=1
19	Q61214	2.28e-83	278	763	0.245	0.189	DYR1A_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Mus musculus OX=10090 GN=Dyrk1a PE=1 SV=1
20	Q63470	2.50e-83	278	763	0.245	0.189	DYR1A_RAT Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Rattus norvegicus OX=10116 GN=Dyrk1a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	2	19.0	ABC1 atypical kinase-like domain
2	PF01636 APH	0.06	24.8	Phosphotransferase enzyme family
3	PF01633 Choline_kinase	45	15.1	Choline/ethanolamine kinase
4	PF06293 Kdo	20	16.1	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF00069 Pkinase	1.7e-55	199.8	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	3.8e-20	83.9	Protein tyrosine and serine/threonine kinase
7	PF01163 RIO1	83	14.2	RIO1 family
8	PF19974 TCAD9	1e+02	13.3	Ternary complex associated domain 9
9	PF10707 YrbL-PhoP_reg	1e+02	14.0	PhoP regulatory network protein YrbL

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356076

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483236	0.815	DDB1- and CUL4-associated factor 7
2	9606.ENSP00000356110	0.691	Nuclear casein kinase and cyclin dependent kinase substrate 1
3	9606.ENSP00000271764	0.689	Eukaryotic translation initiation factor 2D
4	9606.ENSP00000374332	0.686	Translin
5	9606.ENSP00000284995	0.612	tRNA-splicing endonuclease subunit Sen2
6	9606.ENSP00000322242	0.603	RING finger protein 10
7	9606.ENSP00000373215	0.597	Calcium-dependent secretion activator 1
8	9606.ENSP00000364620	0.594	Protein-arginine deiminase type-1
9	9606.ENSP00000231420	0.591	Alanine--glyoxylate aminotransferase 2, mitochondrial
10	9606.ENSP00000336931	0.587	Proline-rich nuclear receptor coactivator 1
11	9606.ENSP00000348510	0.587	General transcription factor 3C polypeptide 1
12	9606.ENSP00000362021	0.581	Transmembrane protein 35A
13	9606.ENSP00000273783	0.547	Translation initiation factor eIF-2B subunit epsilon
14	9606.ENSP00000311344	0.546	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
15	9606.ENSP00000215631	0.545	Growth arrest and DNA damage-inducible protein GADD45 beta
16	9606.ENSP00000342778	0.534	Protein phosphatase, Mg2+/Mn2+ dependent 1G
17	9606.ENSP00000340982	0.530	Sperm-associated antigen 8
18	9606.ENSP00000212015	0.523	NAD-dependent protein deacetylase sirtuin-1
19	9606.ENSP00000229179	0.520	Nuclear pore complex protein Nup107
20	9606.ENSP00000429084	0.511	E3 ubiquitin-protein ligase UBR5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000287	1.000	magnesium ion binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005524	1.000	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.978	regulation of cellular process
GO:0071704	0.972	organic substance metabolic process
GO:0044238	0.939	primary metabolic process
GO:0044237	0.924	cellular metabolic process
GO:0006807	0.905	nitrogen compound metabolic process
GO:0043170	0.883	macromolecule metabolic process
GO:0019538	0.863	protein metabolic process
GO:0048856	0.836	anatomical structure development
GO:0006796	0.769	phosphate-containing compound metabolic process
GO:0036211	0.714	protein modification process
GO:0006468	0.666	protein phosphorylation
GO:0071840	0.392	cellular component organization or biogenesis
GO:0030154	0.388	cell differentiation
GO:0032501	0.387	multicellular organismal process
GO:0048518	0.380	positive regulation of biological process
GO:0016043	0.363	cellular component organization
GO:0048522	0.327	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005654	0.998	nucleoplasm
GO:0005829	0.993	cytosol
GO:0005856	0.952	cytoskeleton
GO:0015630	0.703	microtubule cytoskeleton
GO:0005813	0.450	centrosome
GO:0016604	0.404	nuclear body
GO:0099080	0.383	supramolecular complex
GO:0032991	0.363	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]