StarFunc result for job id O43790

User Input

>input (486 residues)
MTCGSYCGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCG
RSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAF
IDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASEL
NHVQEVLEGYKKKYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLR
RLYEEEIRVLQSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYRSK
CEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAA
LSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG
VGSVNVCVSSSRGGVVCGDLCASTTAPVVSTRVSSVPSNSNVVVGTTNACAPSARVGVCG
GSCKRC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14533	0.344	0.332	8.675E-51	505	0.940	0.905	Q14533.pdb.gz	KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens OX=9606 GN=KRT81 PE=1 SV=3
2	AFDB:Q6IG08	0.644	0.579	2.491E-46	555	0.794	0.695	Q6IG08.pdb.gz	Q6IG08_RAT Type II keratin Kb23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
3	AFDB:Q9NSB2	0.412	0.354	1.893E-31	600	0.609	0.493	Q9NSB2.pdb.gz	KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens OX=9606 GN=KRT84 PE=2 SV=2
4	AFDB:Q9NSB4	0.349	0.333	2.896E-31	513	0.609	0.577	Q9NSB4.pdb.gz	KRT82_HUMAN Keratin, type II cuticular Hb2 OS=Homo sapiens OX=9606 GN=KRT82 PE=1 SV=3
5	AFDB:Q99M73	0.473	0.399	1.824E-30	603	0.601	0.484	Q99M73.pdb.gz	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
6	AFDB:A0A1D5PXP0	0.392	0.367	1.141E-25	522	0.484	0.450	A0A1D5PXP0.pdb.gz
7	AFDB:Q8BGZ7	0.338	0.304	7.719E-25	551	0.510	0.450	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
8	AFDB:Q922U2	0.322	0.275	8.893E-25	580	0.498	0.417	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
9	AFDB:P13647	0.342	0.286	1.025E-24	590	0.506	0.417	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
10	AFDB:P02538	0.332	0.288	1.100E-24	564	0.498	0.429	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
11	PDB:5lj5O	0.094	0.139	1.964	283	0.062	0.106	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:7vdvX	0.096	0.174	6.543	252	0.037	0.071	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
13	PDB:7wooI	0.119	0.229	6.543	187	0.068	0.176	7wooI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KA07	0.0	767	543	0.759	0.680	A0A0G2KA07_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
2	A0A8I5ZLV7	0.0	801	487	0.811	0.809	A0A8I5ZLV7_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
3	A0A8I6AFC7	0.0	805	488	0.817	0.814	A0A8I6AFC7_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
4	A0A8I6G2U8	0.0	783	447	0.772	0.839	A0A8I6G2U8_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
5	A7M776	0.0	833	479	0.835	0.848	A7M776_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
6	O43790	0.0	988	486	1.000	1.000	KRT86_HUMAN Keratin, type II cuticular Hb6 OS=Homo sapiens OX=9606 GN=KRT86 PE=1 SV=1
7	P78385	0.0	881	493	0.916	0.903	KRT83_HUMAN Keratin, type II cuticular Hb3 OS=Homo sapiens OX=9606 GN=KRT83 PE=1 SV=2
8	P78386	0.0	801	507	0.840	0.805	KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens OX=9606 GN=KRT85 PE=1 SV=1
9	Q14533	0.0	907	505	0.940	0.905	KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens OX=9606 GN=KRT81 PE=1 SV=3
10	Q6IG08	0.0	788	555	0.792	0.694	Q6IG08_RAT Type II keratin Kb23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
11	Q99M73	0.0	549	603	0.617	0.498	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
12	Q9NSB2	0.0	551	600	0.613	0.497	KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens OX=9606 GN=KRT84 PE=2 SV=2
13	Q9NSB4	0.0	529	513	0.603	0.571	KRT82_HUMAN Keratin, type II cuticular Hb2 OS=Homo sapiens OX=9606 GN=KRT82 PE=1 SV=3
14	A6NCN2	9.94e-156	444	255	0.453	0.863	KR87P_HUMAN Putative keratin-87 protein OS=Homo sapiens OX=9606 GN=KRT87P PE=5 SV=4
15	Q6P6Q2	2.62e-151	445	576	0.449	0.378	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
16	P13647	7.34e-151	444	590	0.440	0.363	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
17	Q8BGZ7	1.55e-150	442	551	0.490	0.432	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
18	Q922U2	2.32e-150	443	580	0.440	0.369	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
19	O95678	9.39e-150	440	551	0.484	0.426	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
20	P50446	4.88e-149	438	553	0.440	0.387	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15915 BAT	56	15.0	GAF and HTH_10 associated domain
2	PF07888 CALCOCO1	2.5	18.5	Calcium binding and coiled-coil domain (CALCOCO1) like
3	PF20270 CATRA-C	5.9e+02	12.4	CASPASE and TPR Repeat-Associated C-terminal domain
4	PF10473 CENP-F_leu_zip	6.4e+02	11.8	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
5	PF16271 DUF4924	6.6	18.2	Domain of unknown function (DUF4924)
6	PF05960 DUF885	34	15.5	Bacterial protein of unknown function (DUF885)
7	PF00038 Filament	2.3e-95	331.4	Intermediate filament protein
8	PF04399 Glutaredoxin2_C	4.2e+02	12.1	Glutaredoxin 2, C terminal domain
9	PF16208 Keratin_2_head	5.9e-10	51.0	Keratin type II head
10	PF18595 Nuf2_DHR10-like	11	17.5	Nuf2, DHR10-like domain
11	PF18052 Rx_N	8.9e+02	11.6	Rx N-terminal domain
12	PF11544 Spc42p	7.8e+02	11.4	Spindle pole body component Spc42p
13	PF07926 TPR_MLP1_2	0.00059	31.3	TPR/MLP1/MLP2-like protein
14	PF12718 Tropomyosin_1	63	15.2	Tropomyosin like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000444533

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352785	0.667	Desmoglein-4
2	9606.ENSP00000369349	0.623	Keratin, type II cuticular Hb1
3	9606.ENSP00000330101	0.593	Keratin, type II cytoskeletal 2 oral
4	9606.ENSP00000378292	0.589	Keratin, type II cytoskeletal 80
5	9606.ENSP00000329243	0.575	Keratin, type II cytoskeletal 7
6	9606.ENSP00000310338	0.572	Plays a role in the regulation of imprinted gene expression, regulates repressive epigenetic modifications associated with SETDB1. Required for the recruitment or accumulation of SETDB1 to the endogenous retroviruses (ERVs) and maintenance of repressive chromatin configuration, contributing to a subset of the SETDB1-dependent ERV silencing in embryonic stem cells
7	9606.ENSP00000265165	0.537	Lymphoid enhancer-binding factor 1
8	9606.ENSP00000267119	0.529	Keratin, type II cytoskeletal 71
9	9606.ENSP00000369317	0.524	Keratin, type II cytoskeletal 6A
10	9606.ENSP00000310861	0.522	Keratin, type II cytoskeletal 2 epidermal
11	9606.ENSP00000449404	0.519	Keratin, type II cytoskeletal 8
12	9606.ENSP00000307240	0.518	Keratin, type II cytoskeletal 74
13	9606.ENSP00000360811	0.518	LIM/homeobox protein Lhx3
14	9606.ENSP00000448220	0.518	Keratin, type II cytoskeletal 4
15	9606.ENSP00000252242	0.515	Keratin, type II cytoskeletal 5
16	9606.ENSP00000252245	0.514	Keratin, type II cytoskeletal 75
17	9606.ENSP00000342710	0.514	Keratin, type II cytoskeletal 1b
18	9606.ENSP00000307014	0.513	Keratin, type II cytoskeletal 73
19	9606.ENSP00000252252	0.512	Keratin, type II cytoskeletal 6B
20	9606.ENSP00000306261	0.511	Keratin, type II cytoskeletal 78

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.995	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.987	anatomical structure development
GO:0009987	0.961	cellular process
GO:0008544	0.883	epidermis development
GO:0045103	0.498	intermediate filament-based process
GO:0032501	0.475	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0045111	0.989	intermediate filament cytoskeleton
GO:0099513	0.986	polymeric cytoskeletal fiber
GO:0005882	0.981	intermediate filament
GO:0045095	0.974	keratin filament
GO:0070062	0.857	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]