StarFunc result for job id O43791

User Input

>input (374 residues)
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVE
NAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43791	1.000	1.000	9.219E-77	374	1.000	1.000	O43791.pdb.gz	SPOP_HUMAN Speckle-type POZ protein OS=Homo sapiens OX=9606 GN=SPOP PE=1 SV=1
2	AFDB:Q6IQ16	0.865	0.828	8.407E-68	392	0.845	0.806	Q6IQ16.pdb.gz	SPOPL_HUMAN Speckle-type POZ protein-like OS=Homo sapiens OX=9606 GN=SPOPL PE=1 SV=1
3	AFDB:Q9VFP2	0.797	0.385	1.508E-64	829	0.794	0.358	Q9VFP2.pdb.gz	RDX_DROME Protein roadkill OS=Drosophila melanogaster OX=7227 GN=rdx PE=1 SV=2
4	AFDB:Q9SRV1	0.549	0.460	3.639E-35	465	0.313	0.252	Q9SRV1.pdb.gz	BPM4_ARATH BTB/POZ and MATH domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=BPM4 PE=1 SV=1
5	AFDB:A1L4W5	0.577	0.530	2.301E-34	415	0.310	0.280	A1L4W5.pdb.gz	BPM6_ARATH BTB/POZ and MATH domain-containing protein 6 OS=Arabidopsis thaliana OX=3702 GN=BPM6 PE=1 SV=1
6	AFDB:O22286	0.491	0.453	4.094E-34	408	0.310	0.284	O22286.pdb.gz	BPM3_ARATH BTB/POZ and MATH domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=BPM3 PE=1 SV=1
7	AFDB:Q8L765	0.469	0.435	4.094E-34	407	0.283	0.260	Q8L765.pdb.gz	BPM1_ARATH BTB/POZ and MATH domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=BPM1 PE=1 SV=1
8	AFDB:Q9M8J9	0.467	0.433	6.878E-34	406	0.310	0.286	Q9M8J9.pdb.gz	BPM2_ARATH BTB/POZ and MATH domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=BPM2 PE=1 SV=1
9	AFDB:P34371	0.478	0.437	1.296E-33	410	0.286	0.261	P34371.pdb.gz	BAT42_CAEEL BTB and MATH domain-containing protein 42 OS=Caenorhabditis elegans OX=6239 GN=bath-42 PE=1 SV=1
10	AFDB:Q1EBV6	0.584	0.540	1.373E-33	410	0.321	0.293	Q1EBV6.pdb.gz	BPM5_ARATH BTB/POZ and MATH domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=BPM5 PE=1 SV=1
11	PDB:6wcqC	0.273	0.735	1.007E-7	130	0.086	0.246	6wcqC.pdb.gz
12	PDB:7mk2A	0.375	0.394	1.507E-7	354	0.094	0.099	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
13	PDB:7wrgB	0.192	0.108	8.580E-3	783	0.040	0.019	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
14	PDB:7wrgA	0.170	0.095	1.080E-2	812	0.048	0.022	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
15	PDB:1ipkC	0.088	0.087	2.157E-2	379	0.056	0.055	1ipkC.pdb.gz
16	PDB:2vqaA	0.086	0.089	2.565E-2	356	0.051	0.053	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
17	PDB:3q8fA	0.121	0.083	2.717E-2	645	0.056	0.033	3q8fA.pdb.gz	pH effects on binding between the anthrax protective antigen and the host cellular receptor CMG2.
18	PDB:7qe7L	0.112	0.182	4.067E-2	183	0.045	0.093	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:6r7fQ	0.172	0.508	4.308E-2	112	0.051	0.170	6r7fQ.pdb.gz
20	PDB:6xwvD	0.070	0.134	4.834E-2	123	0.035	0.106	6xwvD.pdb.gz	Structural basis for centromere maintenance by Drosophila CENP-A chaperone CAL1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43791	0.0	778	374	1.000	1.000	SPOP_HUMAN Speckle-type POZ protein OS=Homo sapiens OX=9606 GN=SPOP PE=1 SV=1
2	Q6IQ16	0.0	641	392	0.845	0.806	SPOPL_HUMAN Speckle-type POZ protein-like OS=Homo sapiens OX=9606 GN=SPOPL PE=1 SV=1
3	Q6ZWS8	0.0	778	374	1.000	1.000	SPOP_MOUSE Speckle-type POZ protein OS=Mus musculus OX=10090 GN=Spop PE=1 SV=1
4	Q9VFP2	0.0	604	829	0.797	0.359	RDX_DROME Protein roadkill OS=Drosophila melanogaster OX=7227 GN=rdx PE=1 SV=2
5	Q94420	3.42e-51	177	395	0.291	0.276	MEL26_CAEEL Protein maternal effect lethal 26 OS=Caenorhabditis elegans OX=6239 GN=mel-26 PE=1 SV=2
6	K8F7T2	6.53e-49	171	399	0.291	0.273	K8F7T2_CAEEL Protein roadkill OS=Caenorhabditis elegans OX=6239 GN=mel-26 PE=1 SV=1
7	O22286	1.33e-48	171	408	0.316	0.289	BPM3_ARATH BTB/POZ and MATH domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=BPM3 PE=1 SV=1
8	Q9SRV1	3.13e-48	171	465	0.321	0.258	BPM4_ARATH BTB/POZ and MATH domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=BPM4 PE=1 SV=1
9	A1L4W5	2.81e-44	159	415	0.294	0.265	BPM6_ARATH BTB/POZ and MATH domain-containing protein 6 OS=Arabidopsis thaliana OX=3702 GN=BPM6 PE=1 SV=1
10	Q9M8J9	1.55e-42	155	406	0.302	0.278	BPM2_ARATH BTB/POZ and MATH domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=BPM2 PE=1 SV=1
11	Q8L765	3.31e-41	151	407	0.278	0.256	BPM1_ARATH BTB/POZ and MATH domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=BPM1 PE=1 SV=1
12	Q1EBV6	3.17e-40	149	410	0.289	0.263	BPM5_ARATH BTB/POZ and MATH domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=BPM5 PE=1 SV=1
13	P34371	2.34e-35	135	410	0.299	0.273	BAT42_CAEEL BTB and MATH domain-containing protein 42 OS=Caenorhabditis elegans OX=6239 GN=bath-42 PE=1 SV=1
14	Q9NF14	2.67e-25	107	402	0.251	0.234	BAT40_CAEEL BTB and MATH domain-containing protein 40 OS=Caenorhabditis elegans OX=6239 GN=bath-40 PE=1 SV=1
15	P41886	1.32e-24	106	418	0.233	0.208	BAT41_CAEEL BTB and MATH domain-containing protein 41 OS=Caenorhabditis elegans OX=6239 GN=bath-41 PE=1 SV=1
16	Q6DBN1	2.72e-20	90.9	243	0.168	0.259	Y4845_ARATH BTB/POZ domain-containing protein At4g08455 OS=Arabidopsis thaliana OX=3702 GN=At4g08455 PE=1 SV=1
17	B7U179	2.53e-18	89.0	737	0.134	0.068	ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana OX=3702 GN=ABAP1 PE=1 SV=1
18	B9DHT4	4.41e-18	88.2	710	0.136	0.072	ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana OX=3702 GN=ARIA PE=1 SV=2
19	B3DIV9	1.52e-17	86.3	612	0.128	0.078	KL40A_DANRE Kelch-like protein 40a OS=Danio rerio OX=7955 GN=klhl40a PE=2 SV=2
20	Q8IXQ5	3.94e-17	85.1	586	0.142	0.090	KLHL7_HUMAN Kelch-like protein 7 OS=Homo sapiens OX=9606 GN=KLHL7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07707 BACK	5.1	18.6	BTB And C-terminal Kelch
2	PF00651 BTB	3.3e-30	116.0	BTB/POZ domain
3	PF00917 MATH	0.0013	30.3	MATH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008836538.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008824048.1	0.999	Cullin-3
2	1026970.XP_008834498.1	0.990	GLI family zinc finger 3
3	1026970.XP_008825351.1	0.987	Kelch repeat and BTB domain containing 8
4	1026970.XP_008829090.1	0.983	GLI family zinc finger 2
5	1026970.XP_008851565.1	0.980	Speckle-type POZ protein-like
6	1026970.XP_008842299.1	0.964	Zinc finger protein GLI1
7	1026970.XP_008843039.1	0.962	Ring-box 1
8	1026970.XP_008836075.1	0.957	Phosphatase and tensin homolog
9	1026970.XP_008824368.1	0.954	Kelch-like protein 20
10	1026970.XP_008828554.1	0.954	Kelch-like protein 12
11	1026970.XP_008830034.1	0.954	Kelch-like protein 3 isoform X1
12	1026970.XP_008820655.1	0.949	Kelch like family member 21
13	1026970.XP_008846505.1	0.936	Core histone macro-H2A.1 isoform X1
14	1026970.XP_008840510.1	0.935	Kelch like family member 22
15	1026970.XP_008850552.1	0.921	Kelch-like protein 25
16	1026970.XP_008848262.1	0.918	Kelch-like ECH-associated protein 1
17	1026970.XP_008839683.1	0.911	Kelch-like protein 7 isoform X1
18	1026970.XP_008849966.1	0.906	Kelch like family member 8
19	1026970.XP_008845123.1	0.900	Kelch-like protein 42
20	1026970.XP_008838388.1	0.896	Death domain-associated protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.868	enzyme binding
GO:0042802	0.301	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0044265	0.992	cellular macromolecule catabolic process
GO:0006508	0.988	proteolysis
GO:0050789	0.986	regulation of biological process
GO:0030163	0.986	protein catabolic process
GO:0043161	0.979	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0050794	0.958	regulation of cellular process
GO:0048518	0.946	positive regulation of biological process
GO:0050896	0.934	response to stimulus
GO:0019222	0.930	regulation of metabolic process
GO:0060255	0.923	regulation of macromolecule metabolic process
GO:0080090	0.922	regulation of primary metabolic process
GO:0051171	0.914	regulation of nitrogen compound metabolic process
GO:0048519	0.899	negative regulation of biological process
GO:0032446	0.897	protein modification by small protein conjugation
GO:0048522	0.872	positive regulation of cellular process
GO:0016567	0.871	protein ubiquitination
GO:0048583	0.809	regulation of response to stimulus
GO:0000209	0.694	protein polyubiquitination
GO:0080135	0.674	regulation of cellular response to stress
GO:0051716	0.668	cellular response to stimulus
GO:0010941	0.639	regulation of cell death
GO:0048584	0.613	positive regulation of response to stimulus
GO:0043065	0.599	positive regulation of apoptotic process
GO:0031323	0.564	regulation of cellular metabolic process
GO:0048523	0.537	negative regulation of cellular process
GO:0009889	0.532	regulation of biosynthetic process
GO:0019219	0.532	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.521	regulation of RNA metabolic process
GO:0010556	0.520	regulation of macromolecule biosynthetic process
GO:0010468	0.508	regulation of gene expression
GO:0008219	0.499	cell death
GO:0031326	0.495	regulation of cellular biosynthetic process
GO:0006355	0.489	regulation of DNA-templated transcription
GO:0007154	0.483	cell communication
GO:0023051	0.477	regulation of signaling
GO:0010646	0.477	regulation of cell communication
GO:0009966	0.471	regulation of signal transduction
GO:0007165	0.464	signal transduction
GO:1905897	0.439	regulation of response to endoplasmic reticulum stress
GO:1904035	0.439	regulation of epithelial cell apoptotic process
GO:0009892	0.438	negative regulation of metabolic process
GO:0051172	0.401	negative regulation of nitrogen compound metabolic process
GO:0010605	0.380	negative regulation of macromolecule metabolic process
GO:1902531	0.346	regulation of intracellular signal transduction
GO:0006950	0.310	response to stress
GO:0033554	0.304	cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0032991	0.995	protein-containing complex
GO:0000151	0.981	ubiquitin ligase complex
GO:0031461	0.968	cullin-RING ubiquitin ligase complex
GO:0005737	0.890	cytoplasm
GO:0031463	0.873	Cul3-RING ubiquitin ligase complex
GO:0005829	0.430	cytosol
GO:0016604	0.343	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]