StarFunc result for job id O43795

User Input

>input (1136 residues)
MAKMEVKTSLLDNMIGVGDMVLLEPLNEETFINNLKKRFDHSEIYTYIGSVVISVNPYRS
LPIYSPEKVEEYRNRNFYELSPHIFALSDEAYRSLRDQDKDQCILITGESGAGKTEASKL
VMSYVAAVCGKGAEVNQVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDP
LGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASEELLNKLKLERDFSRYNYLSLDSA
KVNGVDDAANFRTVRNAMQIVGFMDHEAESVLAVVAAVLKLGNIEFKPESRVNGLDESKI
KDKNELKEICELTGIDQSVLERAFSFRTVEAKQEKVSTTLNVAQAYYARDALAKNLYSRL
FSWLVNRINESIKAQTKVRKKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTL
KEEQEEYIREDIEWTHIDYFNNAIICDLIENNTNGILAMLDEECLRPGTVTDETFLEKLN
QVCATHQHFESRMSKCSRFLNDTSLPHSCFRIQHYAGKVLYQVEGFVDKNNDLLYRDLSQ
AMWKASHALIKSLFPEGNPAKINLKRPPTAGSQFKASVATLMKNLQTKNPNYIRCIKPND
KKAAHIFNEALVCHQIRYLGLLENVRVRRAGYAFRQAYEPCLERYKMLCKQTWPHWKGPA
RSGVEVLFNELEIPVEEYSFGRSKIFIRNPRTLFKLEDLRKQRLEDLATLIQKIYRGWKC
RTHFLLMKKSQIVIAAWYRRYAQQKRYQQTKSSALVIQSYIRGWKARKILRELKHQKRCK
EAVTTIAAYWHGTQARRELRRLKEEARNKHAIAVIWAYWLGSKARRELKRLKEEARRKHA
VAVIWAYWLGLKVRREYRKFFRANAGKKIYEFTLQRIVQKYFLEMKNKMPSLSPIDKNWP
SRPYLFLDSTHKELKRIFHLWRCKKYRDQFTDQQKLIYEEKLEASELFKDKKALYPSSVG
QPFQGAYLEINKNPKYKKLKDAIEEKIIIAEVVNKINRANGKSTSRIFLLTNNNLLLADQ
KSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRT
TLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSVPTCKRKNNRLLEVAVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0I1S9	0.687	0.687	0.000	1136	1.000	1.000	B0I1S9.pdb.gz	B0I1S9_HUMAN MYO1B variant protein OS=Homo sapiens OX=9606 GN=MYO1B PE=2 SV=1
2	AFDB:E9PDF6	0.657	0.674	0.000	1107	0.971	0.996	E9PDF6.pdb.gz	E9PDF6_HUMAN Myosin IB OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=1
3	AFDB:O88329	0.601	0.652	0.000	1043	0.542	0.591	O88329.pdb.gz	MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus OX=10090 GN=Myo1a PE=2 SV=2
4	AFDB:P47807	0.605	0.655	0.000	1045	0.549	0.597	P47807.pdb.gz	MYO1A_CHICK Unconventional myosin-Ia OS=Gallus gallus OX=9031 GN=MYO1A PE=1 SV=2
5	AFDB:Q9UBC5	0.613	0.665	0.000	1043	0.540	0.589	Q9UBC5.pdb.gz	MYO1A_HUMAN Unconventional myosin-Ia OS=Homo sapiens OX=9606 GN=MYO1A PE=1 SV=1
6	AFDB:O00159	0.589	0.628	5.524E-96	1063	0.401	0.428	O00159.pdb.gz	MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4
7	AFDB:A0A286Y9H2	0.582	0.618	6.988E-96	1069	0.409	0.435	A0A286Y9H2.pdb.gz	A0A286Y9H2_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1cb PE=3 SV=2
8	AFDB:Q23979	0.579	0.633	1.482E-95	1035	0.399	0.438	Q23979.pdb.gz	MY61F_DROME Unconventional myosin IC OS=Drosophila melanogaster OX=7227 GN=Myo61F PE=1 SV=3
9	AFDB:A5PF48	0.552	0.608	1.067E-93	1026	0.394	0.437	A5PF48.pdb.gz	MYO1C_DANRE Unconventional myosin-Ic OS=Danio rerio OX=7955 GN=myo1c PE=3 SV=1
10	AFDB:B8JLK6	0.546	0.620	1.351E-89	993	0.383	0.438	B8JLK6.pdb.gz
11	PDB:4pa0A	0.507	0.585	2.466E-55	974	0.235	0.274	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
12	PDB:4anjA	0.474	0.536	2.353E-54	995	0.230	0.262	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
13	PDB:4pa0B	0.512	0.623	1.010E-53	920	0.232	0.286	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:6ycxB	0.495	0.674	1.110E-51	817	0.190	0.264	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
15	PDB:4p7hB	0.506	0.598	8.778E-51	952	0.232	0.276	4p7hB.pdb.gz
16	PDB:7mf3B	0.491	0.607	2.250E-44	896	0.273	0.346	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.446	0.520	7.645E-40	954	0.264	0.314	5tbyA.pdb.gz
18	PDB:4mk0A	0.083	0.145	1.177E-3	631	0.028	0.051	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:3uzsA	0.085	0.153	1.356E-3	609	0.026	0.048	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
20	PDB:5yqrA	0.084	0.317	4.389E-3	268	0.016	0.067	5yqrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A286Y9H2	776	1069	0.345	0.367	A0A286Y9H2_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1cb PE=3 SV=2
2	A0A2R8Q9G7	774	1068	0.345	0.367	A0A2R8Q9G7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=fj81f11 PE=1 SV=1
3	A0A3B3IU30	670	967	0.316	0.371	A0A3B3IU30_HUMAN Myosin IG OS=Homo sapiens OX=9606 GN=MYO1G PE=1 SV=1
4	A5PF48	750	1026	0.393	0.436	MYO1C_DANRE Unconventional myosin-Ic OS=Danio rerio OX=7955 GN=myo1c PE=3 SV=1
5	B0I1S9	2357	1136	1.000	1.000	B0I1S9_HUMAN MYO1B variant protein OS=Homo sapiens OX=9606 GN=MYO1B PE=2 SV=1
6	B0I1T2	669	1018	0.316	0.353	MYO1G_HUMAN Unconventional myosin-Ig OS=Homo sapiens OX=9606 GN=MYO1G PE=1 SV=2
7	E7F5R7	776	1043	0.345	0.376	E7F5R7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1c PE=1 SV=3
8	E7F9L8	692	1004	0.326	0.369	MYO1D_DANRE Unconventional myosin-Id OS=Danio rerio OX=7955 GN=myo1d PE=2 SV=1
9	E7FDV0	619	1117	0.288	0.293	E7FDV0_DANRE Myosin IEa OS=Danio rerio OX=7955 GN=myo1ea PE=3 SV=1
10	E9PDF6	2278	1107	0.972	0.997	E9PDF6_HUMAN Myosin IB OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=1
11	E9Q634	637	1107	0.296	0.304	MYO1E_MOUSE Unconventional myosin-Ie OS=Mus musculus OX=10090 GN=Myo1e PE=1 SV=1
12	F1PRN2	724	1006	0.331	0.374	MYO1D_CANLF Unconventional myosin-Id OS=Canis lupus familiaris OX=9615 GN=MYO1D PE=1 SV=2
13	F5H6E2	768	1039	0.342	0.374	F5H6E2_HUMAN Myosin IC OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=1
14	O00159	767	1063	0.342	0.366	MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4
15	O00160	625	1098	0.286	0.296	MYO1F_HUMAN Unconventional myosin-If OS=Homo sapiens OX=9606 GN=MYO1F PE=1 SV=3
16	O43795	2357	1136	1.000	1.000	MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=3
17	O88329	1227	1043	0.527	0.574	MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus OX=10090 GN=Myo1a PE=2 SV=2
18	O94832	726	1006	0.338	0.382	MYO1D_HUMAN Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2
19	P22467	656	994	0.318	0.363	MYOA_DICDI Myosin IA heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoA PE=3 SV=2
20	P34092	633	1111	0.287	0.293	MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	21	16.9	AAA ATPase domain
2	PF13401 AAA_22	78	15.0	AAA domain
3	PF04777 Evr1_Alr	3.6e+02	12.9	Erv1 / Alr family
4	PF07475 Hpr_kinase_C	86	14.1	HPr Serine kinase C-terminal domain
5	PF00612 IQ	2.6e-05	34.6	IQ calmodulin-binding motif
6	PF00063 Myosin_head	1.6e-264	890.9	Myosin head (motor domain)
7	PF06017 Myosin_TH1	3.5e-40	149.2	Unconventional myosin tail, actin- and lipid-binding
8	PF00940 RNA_pol	1.3e+02	12.8	DNA-dependent RNA polymerase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376132

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355645	0.751	Actin, alpha skeletal muscle
2	9606.ENSP00000349960	0.746	Actin, cytoplasmic 1
3	9606.ENSP00000458162	0.740	Actin, cytoplasmic 2
4	9606.ENSP00000298910	0.718	Leucine-rich repeat serine/threonine-protein kinase 2
5	9606.ENSP00000252699	0.678	Alpha-actinin-4
6	9606.ENSP00000262942	0.619	Actin-related protein 2/3 complex subunit 1A
7	9606.ENSP00000265748	0.610	Anillin
8	9606.ENSP00000293255	0.533	Calcium-binding protein 5
9	9606.ENSP00000389631	0.530	Actin-related protein 2/3 complex subunit 1B
10	9606.ENSP00000391504	0.529	Coiled-coil domain containing 173
11	9606.ENSP00000331983	0.527	F-actin-uncapping protein LRRC16A
12	9606.ENSP00000264167	0.524	Alkyldihydroxyacetonephosphate synthase, peroxisomal
13	9606.ENSP00000420237	0.523	M14 carboxypeptidases
14	9606.ENSP00000349467	0.522	Calmodulin-1
15	9606.ENSP00000341779	0.521	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
16	9606.ENSP00000268616	0.520	Zinc finger CCHC domain-containing protein 14
17	9606.ENSP00000372023	0.520	Serine/threonine-protein kinase Chk2
18	9606.ENSP00000287859	0.513	Protein odr-4 homolog
19	9606.ENSP00000378152	0.513	AKT-interacting protein
20	9606.ENSP00000398048	0.506	Alpha-protein kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000146	0.999	microfilament motor activity
GO:0043168	0.998	anion binding
GO:0003779	0.998	actin binding
GO:0032553	0.998	ribonucleotide binding
GO:0044877	0.982	protein-containing complex binding
GO:0035639	0.973	purine ribonucleoside triphosphate binding
GO:0032555	0.969	purine ribonucleotide binding
GO:0030554	0.951	adenyl nucleotide binding
GO:0032559	0.905	adenyl ribonucleotide binding
GO:0005524	0.892	ATP binding
GO:0005543	0.745	phospholipid binding
GO:0003824	0.740	catalytic activity
GO:0051015	0.716	actin filament binding
GO:0035091	0.618	phosphatidylinositol binding
GO:1901981	0.590	phosphatidylinositol phosphate binding
GO:0005516	0.301	calmodulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0016043	0.956	cellular component organization
GO:0051179	0.946	localization
GO:0097435	0.906	supramolecular fiber organization
GO:0030029	0.810	actin filament-based process
GO:0007010	0.798	cytoskeleton organization
GO:0016192	0.787	vesicle-mediated transport
GO:0065007	0.715	biological regulation
GO:0050789	0.713	regulation of biological process
GO:0050794	0.621	regulation of cellular process
GO:0030036	0.538	actin cytoskeleton organization
GO:0051641	0.447	cellular localization
GO:0007015	0.404	actin filament organization
GO:0050896	0.340	response to stimulus
GO:0022607	0.321	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0005622	0.997	intracellular anatomical structure
GO:0071944	0.995	cell periphery
GO:0005886	0.989	plasma membrane
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:0005737	0.966	cytoplasm
GO:0005576	0.961	extracellular region
GO:0043232	0.956	intracellular non-membrane-bounded organelle
GO:0005829	0.895	cytosol
GO:0070062	0.894	extracellular exosome
GO:0005856	0.880	cytoskeleton
GO:0015629	0.856	actin cytoskeleton
GO:0120025	0.813	plasma membrane bounded cell projection
GO:0012505	0.746	endomembrane system
GO:0032991	0.488	protein-containing complex
GO:0099080	0.485	supramolecular complex
GO:0005884	0.468	actin filament
GO:0097708	0.416	intracellular vesicle
GO:0098862	0.375	cluster of actin-based cell projections
GO:0031410	0.349	cytoplasmic vesicle
GO:0005903	0.331	brush border
GO:0043233	0.310	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.999	myosin ATPase.

[back to server]