StarFunc result for job id O43805

User Input

>input (119 residues)
MTQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNEN
LARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAPDQKSSGGRDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43805	1.000	1.000	2.404E-14	119	1.000	1.000	O43805.pdb.gz	SSNA1_HUMAN Microtubule nucleation factor SSNA1 OS=Homo sapiens OX=9606 GN=SSNA1 PE=1 SV=2
2	AFDB:Q6NZ07	0.209	0.050	3.735	572	0.118	0.024	Q6NZ07.pdb.gz	NCLN_DANRE BOS complex subunit ncln OS=Danio rerio OX=7955 GN=ncln PE=2 SV=1
3	AFDB:A2AWU1	0.624	0.167	5.214	485	0.218	0.054	A2AWU1.pdb.gz	A2AWU1_DANRE Olfactomedin 1a OS=Danio rerio OX=7955 GN=zgc:111962 PE=4 SV=1
4	AFDB:P31381	0.279	0.073	5.214	517	0.067	0.015	P31381.pdb.gz	FUN26_YEAST Nucleoside transporter FUN26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FUN26 PE=1 SV=1
5	AFDB:Q21812	0.212	0.053	5.214	512	0.076	0.018	Q21812.pdb.gz	Q21812_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-5 PE=1 SV=1
6	AFDB:Q6X7K1	0.255	0.124	5.667	260	0.050	0.023	Q6X7K1.pdb.gz	WOX2_ARATH WUSCHEL-related homeobox 2 OS=Arabidopsis thaliana OX=3702 GN=WOX2 PE=2 SV=1
7	AFDB:Q5XEZ0	0.185	0.072	6.160	365	0.084	0.027	Q5XEZ0.pdb.gz	WTR1_ARATH WAT1-related protein At1g01070 OS=Arabidopsis thaliana OX=3702 GN=At1g01070 PE=2 SV=1
8	AFDB:B0BL87	0.225	0.060	6.695	465	0.067	0.017	B0BL87.pdb.gz	B0BL87_CHICK Monocyte differentiation antigen CD14 OS=Gallus gallus OX=9031 GN=Cd14 PE=2 SV=1
9	AFDB:G5EFL5	0.344	0.035	7.277	1424	0.210	0.018	G5EFL5.pdb.gz	G5EFL5_CAEEL PDZ and LIM domain protein Zasp OS=Caenorhabditis elegans OX=6239 GN=alp-1 PE=1 SV=1
10	AFDB:Q494Q2	0.210	0.076	8.597	358	0.059	0.020	Q494Q2.pdb.gz	HPAT2_ARATH Hydroxyproline O-arabinosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=HPAT2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43805	1.59e-81	236	119	1.000	1.000	SSNA1_HUMAN Microtubule nucleation factor SSNA1 OS=Homo sapiens OX=9606 GN=SSNA1 PE=1 SV=2
2	Q9JJ94	2.95e-79	230	119	0.975	0.975	SSNA1_MOUSE Microtubule nucleation factor SSNA1 OS=Mus musculus OX=10090 GN=Ssna1 PE=1 SV=1
3	Q9XF62	6.29e-41	133	111	0.546	0.586	SSNA1_CHLRE Microtubule nucleation factor SSNA1 OS=Chlamydomonas reinhardtii OX=3055 GN=SSNA1 PE=1 SV=1
4	Q388J0	3.18e-13	64.7	195	0.412	0.251	Q388J0_TRYB2 Sjogren s syndrome nuclear autoantigen 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2720 PE=4 SV=1
5	Q5U7D2	0.049	34.7	917	0.202	0.026	Q5U7D2_DANRE Exostoses (Multiple)-like 3 OS=Danio rerio OX=7955 GN=im:7141548 PE=1 SV=1
6	Q9XZ08	0.060	34.3	972	0.151	0.019	EXT3_DROME Exostosin-3 OS=Drosophila melanogaster OX=7227 GN=botv PE=1 SV=1
7	Q38EM6	0.20	33.1	1690	0.151	0.011	Q38EM6_TRYB2 Adenosine monophosphate deaminase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5250 PE=3 SV=1
8	A6H611	0.34	32.3	711	0.143	0.024	MIPEP_MOUSE Mitochondrial intermediate peptidase OS=Mus musculus OX=10090 GN=Mipep PE=1 SV=1
9	Q2Q1W5	0.36	32.3	3664	0.218	0.007	Q2Q1W5_DANRE Laminin alpha 5 OS=Danio rerio OX=7955 GN=wu:fb81a10 PE=1 SV=1
10	A0A0R4INI3	0.43	32.0	1938	0.252	0.015	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
11	Q508P8	0.45	32.0	1938	0.252	0.015	Q508P8_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=im:6897999 PE=1 SV=1
12	Q8MMD2	0.50	32.0	1232	0.202	0.019	Q8MMD2_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform B OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
13	B6IDE1	0.68	31.6	1939	0.244	0.015	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
14	Q2M2I5	0.77	31.2	525	0.168	0.038	K1C24_HUMAN Keratin, type I cytoskeletal 24 OS=Homo sapiens OX=9606 GN=KRT24 PE=1 SV=1
15	Q8MMD3	0.80	31.2	1106	0.202	0.022	Q8MMD3_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform C OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
16	Q910C5	0.85	31.2	1931	0.244	0.015	Q910C5_CHICK Chick atrial myosin heavy chain OS=Gallus gallus OX=9031 PE=2 SV=1
17	Q9UPN3	0.95	31.2	7388	0.193	0.003	MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4
18	E3CTP7	0.96	30.8	792	0.202	0.030	E3CTP7_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform D OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
19	A0A0G2K484	1.2	30.8	1939	0.244	0.015	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
20	F1LMU0	1.3	30.4	1939	0.244	0.015	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	1.1e+02	14.3	Afadin- and alpha -actinin-Binding
2	PF17675 APG6_N	0.54	22.2	Apg6 coiled-coil region
3	PF12037 ATAD3_N	3.5e+02	11.9	ATPase family AAA domain-containing protein 3, N-terminal
4	PF04108 ATG17_like	65	14.4	Autophagy protein ATG17-like domain
5	PF05791 Bacillus_HBL	2.9	19.2	Bacillus haemolytic enterotoxin (HBL)
6	PF04513 Baculo_PEP_C	4.9e+02	12.2	Baculovirus polyhedron envelope protein, PEP, C terminus
7	PF09789 CC149	2.5	19.0	Coiled-coil domain-containing protein 149-A
8	PF06840 DUF1241	20	16.3	Protein of unknown function (DUF1241)
9	PF07889 DUF1664	3.3e+02	12.7	Protein of unknown function (DUF1664)
10	PF10303 DUF2408	42	16.2	Protein of unknown function (DUF2408)
11	PF11285 DUF3086	56	14.3	Protein of unknown function (DUF3086)
12	PF11932 DUF3450	4.8e+02	11.4	Protein of unknown function (DUF3450)
13	PF13158 DUF3993	5.5e+02	12.2	Protein of unknown function (DUF3993)
14	PF13863 DUF4200	3.2e+02	13.1	Domain of unknown function (DUF4200)
15	PF19314 DUF5917	16	17.1	Family of unknown function (DUF5917)
16	PF05266 DUF724	46	15.3	Protein of unknown function (DUF724)
17	PF20492 ERM_helical	2e+02	13.5	Ezrin/radixin/moesin, alpha-helical domain
18	PF05149 Flagellar_rod	3.4e+02	12.1	Paraflagellar rod protein
19	PF09766 FmiP_Thoc5	2.2e+02	12.5	Fms-interacting protein/Thoc5
20	PF13851 GAS	2.3e+02	12.5	Growth-arrest specific micro-tubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313752

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480893	0.914	Spastin
2	9606.ENSP00000432279	0.766	Charged multivesicular body protein 1b
3	9606.ENSP00000251413	0.738	Tubulin gamma-1 chain
4	9606.ENSP00000342262	0.719	Nucleoporin Nup43
5	9606.ENSP00000370021	0.716	Centlein
6	9606.ENSP00000217958	0.678	26S proteasome non-ATPase regulatory subunit 10
7	9606.ENSP00000393557	0.675	Electrogenic sodium bicarbonate cotransporter 1
8	9606.ENSP00000347748	0.667	Transmembrane protein adipocyte associated 1
9	9606.ENSP00000315931	0.665	Adenosylhomocysteinase 3
10	9606.ENSP00000055077	0.660	Replication factor C subunit 2
11	9606.ENSP00000351155	0.648	Atlastin-1
12	9606.ENSP00000414147	0.643	Spartin
13	9606.ENSP00000267484	0.641	Reticulon-1
14	9606.ENSP00000356381	0.630	Katanin p60 ATPase-containing subunit A1
15	9606.ENSP00000475727	0.628	TBC1 domain family member 7
16	9606.ENSP00000377617	0.600	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0008017	0.996	microtubule binding
GO:0043621	0.980	protein self-association

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0016043	0.984	cellular component organization
GO:0006996	0.964	organelle organization
GO:0032502	0.942	developmental process
GO:0007017	0.938	microtubule-based process
GO:0032501	0.926	multicellular organismal process
GO:0048856	0.910	anatomical structure development
GO:1990138	0.880	neuron projection extension
GO:0000904	0.829	cell morphogenesis involved in differentiation
GO:0065007	0.743	biological regulation
GO:0048675	0.741	axon extension
GO:0050789	0.711	regulation of biological process
GO:0050794	0.618	regulation of cellular process
GO:0007010	0.610	cytoskeleton organization
GO:0000226	0.424	microtubule cytoskeleton organization
GO:0022607	0.349	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036064	0.999	ciliary basal body
GO:0005737	0.991	cytoplasm
GO:0005829	0.968	cytosol
GO:0032991	0.932	protein-containing complex
GO:0005634	0.900	nucleus
GO:0005813	0.890	centrosome
GO:0099080	0.760	supramolecular complex
GO:0030496	0.712	midbody
GO:0005814	0.687	centriole
GO:0099512	0.666	supramolecular fiber
GO:0099568	0.510	cytoplasmic region
GO:0032838	0.503	plasma membrane bounded cell projection cytoplasm
GO:0070013	0.441	intracellular organelle lumen
GO:0097014	0.417	ciliary plasm
GO:0005930	0.408	axoneme
GO:0043005	0.324	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]