StarFunc result for job id O43808

User Input

>input (307 residues)
MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEG
LLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTT
PLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPA
IQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPE
NRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMG
LKRAHQH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43808	1.000	1.000	1.979E-40	307	1.000	1.000	O43808.pdb.gz	PM34_HUMAN Peroxisomal membrane protein PMP34 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1
2	AFDB:F6RTR7	0.616	0.802	1.319E-21	234	0.762	1.000	F6RTR7.pdb.gz	F6RTR7_HUMAN Solute carrier family 25 member 17 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1
3	AFDB:O04200	0.799	0.744	1.773E-16	331	0.322	0.299	O04200.pdb.gz	PXN_ARATH Peroxisomal nicotinamide adenine dinucleotide carrier OS=Arabidopsis thaliana OX=3702 GN=PXN PE=1 SV=1
4	AFDB:Q8RWA5	0.800	0.684	2.607E-16	363	0.319	0.270	Q8RWA5.pdb.gz	NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDT2 PE=1 SV=1
5	AFDB:O22261	0.812	0.799	3.369E-16	312	0.322	0.317	O22261.pdb.gz	NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NDT1 PE=1 SV=2
6	AFDB:B6ZJZ9	0.789	0.763	7.278E-16	318	0.309	0.299	B6ZJZ9.pdb.gz	PNC1_SOYBN Peroxisomal adenine nucleotide carrier 1 OS=Glycine max OX=3847 GN=PNC1 PE=2 SV=1
7	AFDB:Q7XA87	0.831	0.829	8.637E-16	308	0.306	0.305	Q7XA87.pdb.gz	FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FOLT1 PE=2 SV=1
8	AFDB:Q6IZB5	0.829	0.807	1.165E-15	316	0.293	0.285	Q6IZB5.pdb.gz	S2532_CRIGR Solute carrier family 25 member 32 OS=Cricetulus griseus OX=10029 GN=SLC25A32 PE=1 SV=1
9	AFDB:Q38DI5	0.726	0.680	4.390E-15	330	0.264	0.245	Q38DI5.pdb.gz	Q38DI5_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3200 PE=3 SV=1
10	AFDB:P39953	0.816	0.752	4.582E-15	335	0.267	0.245	P39953.pdb.gz	YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEA6 PE=1 SV=1
11	PDB:4c9qB	0.721	0.760	8.351E-10	290	0.212	0.224	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.706	0.736	9.910E-10	293	0.189	0.198	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.516	0.536	1.068E-5	292	0.212	0.223	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:5mkkB	0.175	0.111	1.922E-1	577	0.156	0.083	5mkkB.pdb.gz
15	PDB:6wpwR	0.157	0.134	2.094E-1	398	0.140	0.108	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
16	PDB:6nwdA	0.185	0.213	2.281E-1	246	0.160	0.199	6nwdA.pdb.gz	X-ray Crystallographic Structure and Oligomerization of Gloeobacter Rhodopsin.
17	PDB:7oseA	0.242	0.174	2.484E-1	503	0.114	0.070	7oseA.pdb.gz	Structure of Escherichia coli cytochrome bd-II type oxidase with bound aurachin D.
18	PDB:7b93N	0.159	0.148	2.706E-1	345	0.130	0.116	7b93N.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
19	PDB:7oseB	0.207	0.177	4.333E-1	377	0.114	0.093	7oseB.pdb.gz	Structure of Escherichia coli cytochrome bd-II type oxidase with bound aurachin D.
20	PDB:7p54A	0.117	0.102	4.333E-1	397	0.143	0.111	7p54A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43808	0.0	629	307	1.000	1.000	PM34_HUMAN Peroxisomal membrane protein PMP34 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1
2	O70579	0.0	585	307	0.954	0.954	PM34_MOUSE Peroxisomal membrane protein PMP34 OS=Mus musculus OX=10090 GN=Slc25a17 PE=1 SV=1
3	B0QYW5	2.82e-142	402	225	0.645	0.880	B0QYW5_HUMAN Solute carrier family 25 member 17 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1
4	F6RTR7	4.25e-142	402	234	0.638	0.838	F6RTR7_HUMAN Solute carrier family 25 member 17 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1
5	Q7XA87	6.85e-40	143	308	0.329	0.328	FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FOLT1 PE=2 SV=1
6	O04200	2.59e-38	140	331	0.313	0.290	PXN_ARATH Peroxisomal nicotinamide adenine dinucleotide carrier OS=Arabidopsis thaliana OX=3702 GN=PXN PE=1 SV=1
7	B6ZJZ9	4.55e-36	134	318	0.319	0.308	PNC1_SOYBN Peroxisomal adenine nucleotide carrier 1 OS=Glycine max OX=3847 GN=PNC1 PE=2 SV=1
8	Q8VZS0	1.96e-33	127	321	0.300	0.287	PNC2_ARATH Peroxisomal adenine nucleotide carrier 2 OS=Arabidopsis thaliana OX=3702 GN=PNC2 PE=1 SV=1
9	Q5BGS3	1.69e-32	124	336	0.277	0.253	Q5BGS3_EMENI Peroxisomal carrier protein, putative (AFU_orthologue AFUA_1G03440) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00257 PE=3 SV=1
10	Q8RWA5	1.76e-32	125	363	0.309	0.262	NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDT2 PE=1 SV=1
11	Q9MA90	2.42e-32	124	322	0.280	0.267	PNC1_ARATH Peroxisomal adenine nucleotide carrier 1 OS=Arabidopsis thaliana OX=3702 GN=PNC1 PE=1 SV=1
12	Q6IZB5	1.16e-31	122	316	0.303	0.294	S2532_CRIGR Solute carrier family 25 member 32 OS=Cricetulus griseus OX=10029 GN=SLC25A32 PE=1 SV=1
13	Q8BMG8	1.35e-30	119	316	0.296	0.288	S2532_MOUSE Solute carrier family 25 member 32 OS=Mus musculus OX=10090 GN=Slc25a32 PE=1 SV=1
14	O22261	5.40e-30	117	312	0.293	0.288	NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NDT1 PE=1 SV=2
15	Q38DI5	1.04e-29	117	330	0.280	0.261	Q38DI5_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3200 PE=3 SV=1
16	Q9SUV1	1.45e-29	117	392	0.300	0.235	BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BT1 PE=1 SV=1
17	P39953	1.55e-29	116	335	0.296	0.272	YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEA6 PE=1 SV=1
18	Q9H2D1	1.02e-27	111	315	0.287	0.279	S2532_HUMAN Solute carrier family 25 member 32 OS=Homo sapiens OX=9606 GN=SLC25A32 PE=1 SV=2
19	P40556	6.38e-26	107	373	0.270	0.223	YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIA6 PE=1 SV=1
20	Q382A1	1.21e-25	106	339	0.267	0.242	Q382A1_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5960 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	1.9e-52	186.5	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000390722

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357051	0.994	Peroxisomal biogenesis factor 19
2	9606.ENSP00000218104	0.993	ATP-binding cassette sub-family D member 1
3	9606.ENSP00000359233	0.988	ATP-binding cassette sub-family D member 3
4	9606.ENSP00000356563	0.987	Peroxisomal biogenesis factor 3
5	9606.ENSP00000241041	0.986	Peroxisomal membrane protein PEX16
6	9606.ENSP00000349016	0.984	Peroxisomal membrane protein PEX14
7	9606.ENSP00000310688	0.983	ATP-binding cassette sub-family D member 2
8	9606.ENSP00000349543	0.982	Peroxisome biogenesis factor 2
9	9606.ENSP00000295030	0.980	Peroxisomal membrane protein PEX13
10	9606.ENSP00000386385	0.980	Peroxisomal membrane protein 4
11	9606.ENSP00000358312	0.979	Peroxisomal membrane protein 11B
12	9606.ENSP00000482609	0.978	Peroxisome assembly protein 12
13	9606.ENSP00000331106	0.974	Peroxisome assembly protein 26
14	9606.ENSP00000391601	0.974	Peroxisomal targeting signal 1 receptor
15	9606.ENSP00000379568	0.962	Acyl-CoA-binding domain-containing protein 5
16	9606.ENSP00000223136	0.956	Mitochondrial fission 1 protein
17	9606.ENSP00000321271	0.955	Peroxisomal membrane protein 2
18	9606.ENSP00000339017	0.930	ATPase family AAA domain-containing protein 1
19	9606.ENSP00000220822	0.914	Ganglioside-induced differentiation-associated protein 1
20	9606.ENSP00000345774	0.913	Fatty aldehyde dehydrogenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0015217	0.995	ADP transmembrane transporter activity
GO:0005347	0.995	ATP transmembrane transporter activity
GO:0015101	0.993	organic cation transmembrane transporter activity
GO:0051087	0.991	chaperone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0006862	0.981	nucleotide transport
GO:0071704	0.972	organic substance metabolic process
GO:0044237	0.970	cellular metabolic process
GO:0044238	0.957	primary metabolic process
GO:0015865	0.953	purine nucleotide transport
GO:0009062	0.928	fatty acid catabolic process
GO:0019395	0.927	fatty acid oxidation
GO:0006635	0.895	fatty acid beta-oxidation
GO:0015711	0.879	organic anion transport
GO:0006869	0.852	lipid transport
GO:0051503	0.822	adenine nucleotide transport
GO:0015718	0.797	monocarboxylic acid transport
GO:0015908	0.780	fatty acid transport
GO:1901264	0.427	carbohydrate derivative transport
GO:0015868	0.399	purine ribonucleotide transport
GO:0015867	0.339	ATP transport
GO:0065007	0.324	biological regulation
GO:0071840	0.305	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005778	0.998	peroxisomal membrane
GO:0005829	0.997	cytosol
GO:0005739	0.967	mitochondrion
GO:0070013	0.723	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]