StarFunc result for job id O43809

User Input

>input (227 residues)
MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV
AARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEG
LKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQ
EKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R6W2	0.972	0.972	7.875E-50	227	1.000	1.000	A0A024R6W2.pdb.gz
2	PDB:3mdgB	0.880	0.950	2.537E-45	210	0.925	1.000	3mdgB.pdb.gz	Structural basis of UGUA recognition by the Nudix protein CFI(m)25 and implications for a regulatory role in mRNA 3' processing.
3	AFDB:Q93716	0.861	0.861	2.850E-37	227	0.621	0.621	Q93716.pdb.gz	Q93716_CAEEL Cleavage and polyadenylation specificity factor subunit 5 OS=Caenorhabditis elegans OX=6239 GN=cfim-1 PE=1 SV=1
4	AFDB:Q8GXS3	0.847	0.960	1.092E-32	200	0.502	0.570	Q8GXS3.pdb.gz	CFIS2_ARATH Pre-mRNA cleavage factor Im 25 kDa subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CFIS2 PE=1 SV=1
5	AFDB:Q94AF0	0.824	0.842	3.281E-28	222	0.401	0.410	Q94AF0.pdb.gz	CFIS1_ARATH Pre-mRNA cleavage factor Im 25 kDa subunit 1 OS=Arabidopsis thaliana OX=3702 GN=CFIS1 PE=1 SV=1
6	AFDB:Q57WN8	0.741	0.564	2.115E-21	300	0.317	0.240	Q57WN8.pdb.gz	Q57WN8_TRYB2 Cleavage and polyadenylation specificity factor subunit 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.990 PE=3 SV=1
7	AFDB:Q9U2M7	0.420	0.643	4.100E-6	138	0.119	0.196	Q9U2M7.pdb.gz	AP4A_CAEEL Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Caenorhabditis elegans OX=6239 GN=ndx-4 PE=1 SV=1
8	PDB:2qjoB	0.407	0.290	4.138E-6	336	0.141	0.095	2qjoB.pdb.gz	Bifunctional NMN Adenylyltransferase/ADP-Ribose Pyrophosphatase: Structure and Function in Bacterial NAD Metabolism.
9	PDB:1nqzA	0.389	0.501	6.741E-6	171	0.106	0.140	1nqzA.pdb.gz
10	AFDB:P56380	0.365	0.526	7.099E-6	147	0.093	0.143	P56380.pdb.gz	AP4A_MOUSE Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Mus musculus OX=10090 GN=Nudt2 PE=1 SV=3
11	AFDB:Q55928	0.407	0.290	8.525E-6	339	0.128	0.086	Q55928.pdb.gz	NADM_SYNY3 Bifunctional NMN adenylyltransferase/Nudix hydrolase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr0787 PE=1 SV=1
12	AFDB:P0AEI6	0.430	0.606	9.061E-6	153	0.101	0.150	P0AEI6.pdb.gz	NUDJ_ECOLI Phosphatase NudJ OS=Escherichia coli (strain K12) OX=83333 GN=nudJ PE=1 SV=1
13	AFDB:P50584	0.356	0.519	1.024E-5	147	0.084	0.129	P50584.pdb.gz	AP4A_PIG Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Sus scrofa OX=9823 GN=NUDT2 PE=1 SV=3
14	PDB:1ktgA	0.440	0.688	1.167E-5	137	0.115	0.190	1ktgA.pdb.gz	The crystal structure of diadenosine tetraphosphate hydrolase from Caenorhabditis elegans in free and binary complex forms
15	PDB:5t3pC	0.396	0.405	1.319E-5	221	0.084	0.086	5t3pC.pdb.gz
16	PDB:2o1cA	0.425	0.613	1.490E-5	147	0.115	0.177	2o1cA.pdb.gz	Structure and function of the E. coli dihydroneopterin triphosphate pyrophosphatase: a Nudix enzyme involved in folate biosynthesis.
17	PDB:2rrkA	0.414	0.636	1.490E-5	140	0.115	0.186	2rrkA.pdb.gz
18	PDB:2kdvA	0.331	0.436	2.427E-5	164	0.123	0.171	2kdvA.pdb.gz
19	PDB:7auoA	0.417	0.593	3.720E-5	149	0.110	0.168	7auoA.pdb.gz	Multiple substrate recognition by yeast diadenosine and diphosphoinositol polyphosphate phosphohydrolase through phosphate clamping.
20	PDB:1xscA	0.363	0.512	4.467E-5	153	0.097	0.144	1xscA.pdb.gz	Structure and Substrate-binding Mechanism of Human Ap4A Hydrolase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43809	7.84e-170	468	227	1.000	1.000	CPSF5_HUMAN Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1
2	Q9CQF3	4.39e-169	466	227	0.996	0.996	CPSF5_MOUSE Cleavage and polyadenylation specificity factor subunit 5 OS=Mus musculus OX=10090 GN=Nudt21 PE=1 SV=1
3	Q93716	3.85e-104	302	227	0.608	0.608	Q93716_CAEEL Cleavage and polyadenylation specificity factor subunit 5 OS=Caenorhabditis elegans OX=6239 GN=cfim-1 PE=1 SV=1
4	Q8GXS3	5.11e-84	250	200	0.507	0.575	CFIS2_ARATH Pre-mRNA cleavage factor Im 25 kDa subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CFIS2 PE=1 SV=1
5	Q94AF0	1.31e-59	189	222	0.401	0.410	CFIS1_ARATH Pre-mRNA cleavage factor Im 25 kDa subunit 1 OS=Arabidopsis thaliana OX=3702 GN=CFIS1 PE=1 SV=1
6	Q57WN8	1.06e-24	100	300	0.335	0.253	Q57WN8_TRYB2 Cleavage and polyadenylation specificity factor subunit 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.990 PE=3 SV=1
7	Q9LUB7	0.062	36.6	574	0.115	0.045	OBE2_ARATH Protein OBERON 2 OS=Arabidopsis thaliana OX=3702 GN=OBE2 PE=1 SV=1
8	Q383U8	0.11	35.4	246	0.141	0.130	Q383U8_TRYB2 NUDIX hydrolase, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1570 PE=3 SV=1
9	O30126	0.76	33.1	534	0.088	0.037	SEPS_ARCFU O-phosphoserine--tRNA(Cys) ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=sepS PE=1 SV=1
10	Q9W0M1	2.5	32.0	1978	0.123	0.014	CE290_DROME Centrosomal protein Cep290 OS=Drosophila melanogaster OX=7227 GN=Cep290 PE=1 SV=2
11	O17560	3.5	31.2	487	0.088	0.041	O17560_CAEEL Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-20 PE=1 SV=2
12	Q5T4B2	4.7	30.8	595	0.097	0.037	GT253_HUMAN Inactive glycosyltransferase 25 family member 3 OS=Homo sapiens OX=9606 GN=CERCAM PE=1 SV=1
13	Q9SU14	5.5	30.4	282	0.093	0.074	NUDT7_ARATH Nudix hydrolase 7 OS=Arabidopsis thaliana OX=3702 GN=NUDT7 PE=1 SV=1
14	Q24314	6.2	30.4	1002	0.106	0.024	VPS18_DROME Vacuolar protein sorting-associated protein 18 homolog OS=Drosophila melanogaster OX=7227 GN=dor PE=1 SV=3
15	A0A0B4KF82	7.5	30.4	1818	0.075	0.009	A0A0B4KF82_DROME Canoe, isoform I OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
16	Q8IPP3	7.5	30.4	1817	0.075	0.009	Q8IPP3_DROME Canoe, isoform D OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=2
17	A0A0B4KG43	9.9	30.0	1968	0.075	0.009	A0A0B4KG43_DROME Canoe, isoform H OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
18	Q95TT5	10.0	30.0	2051	0.075	0.008	Q95TT5_DROME LD24616p OS=Drosophila melanogaster OX=7227 GN=cno PE=2 SV=1
19	Q9VN82	10.0	30.0	2051	0.075	0.008	Q9VN82_DROME Canoe, isoform E OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13869 NUDIX_2	8.3e-78	271.6	Nucleotide hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006053724.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006064331.1	0.999	Cleavage and polyadenylation specificity factor subunit 6-like isoform X1
2	89462.XP_006076616.1	0.999	Cleavage and polyadenylation specificity factor subunit 7 isoform X1
3	89462.XP_006041394.1	0.995	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 27 samples with support for all annotated introns
4	89462.XP_006047830.1	0.988	pre-mRNA 3'-end-processing factor FIP1
5	89462.XP_006059278.1	0.986	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns
6	89462.XP_006055699.1	0.984	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 26 samples with support for all annotated introns
7	89462.XP_006071303.1	0.972	Cleavage and polyadenylation specificity factor subunit 2 isoform X1
8	89462.XP_006064676.1	0.970	Cleavage and polyadenylation specificity factor subunit 1 isoform X1
9	89462.XP_006066012.1	0.969	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 27 samples with support for all annotated introns
10	89462.XP_006066014.1	0.969	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
11	89462.XP_006067519.1	0.969	Zinc finger CCCH domain-containing protein 4
12	89462.XP_006073850.1	0.965	Cleavage and polyadenylation specificity factor subunit 3 isoform X1
13	89462.XP_006078326.1	0.964	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
14	89462.XP_006078789.1	0.959	YTH domain-containing protein 1 isoform X1
15	89462.XP_006050467.1	0.957	Serine/arginine-rich splicing factor 3-like
16	89462.XP_006049055.1	0.955	Cleavage stimulation factor subunit 1 isoform X1
17	89462.XP_006066972.1	0.938	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
18	89462.XP_006072411.1	0.938	Cleavage stimulation factor subunit 2 tau variant isoform X1
19	89462.XP_006061617.1	0.913	pre-mRNA 3' end processing protein WDR33 isoform X1
20	89462.XP_006045210.1	0.909	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: deleted 1 base in 1 codon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.982	identical protein binding
GO:0003723	0.969	RNA binding
GO:0003729	0.467	mRNA binding
GO:0042826	0.452	histone deacetylase binding
GO:0035925	0.448	mRNA 3'-UTR AU-rich region binding
GO:0042803	0.377	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0044238	0.990	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0048518	0.985	positive regulation of biological process
GO:0043170	0.985	macromolecule metabolic process
GO:0006396	0.984	RNA processing
GO:0048522	0.921	positive regulation of cellular process
GO:1903311	0.914	regulation of mRNA metabolic process
GO:0016071	0.889	mRNA metabolic process
GO:0010468	0.866	regulation of gene expression
GO:0071840	0.816	cellular component organization or biogenesis
GO:0044085	0.735	cellular component biogenesis
GO:0006397	0.675	mRNA processing
GO:0010608	0.649	post-transcriptional regulation of gene expression
GO:0016043	0.597	cellular component organization
GO:2000736	0.588	regulation of stem cell differentiation
GO:0022613	0.531	ribonucleoprotein complex biogenesis
GO:0050684	0.486	regulation of mRNA processing
GO:0043933	0.457	protein-containing complex organization
GO:0031123	0.444	RNA 3'-end processing
GO:0065003	0.409	protein-containing complex assembly
GO:0051173	0.300	positive regulation of nitrogen compound metabolic process
GO:0031325	0.300	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.992	nucleoplasm
GO:0043232	0.966	intracellular non-membrane-bounded organelle
GO:0032991	0.888	protein-containing complex
GO:0016604	0.870	nuclear body
GO:0005737	0.826	cytoplasm
GO:0005856	0.635	cytoskeleton
GO:0140513	0.520	nuclear protein-containing complex
GO:0015630	0.502	microtubule cytoskeleton
GO:0005815	0.443	microtubule organizing center
GO:0005813	0.424	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]