StarFunc result for job id O43819

User Input

>input (266 residues)
MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTR
LLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFR
GQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARY
VQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDY
YGRSRSAEQISDSVRRHMAAFRSVLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43819	1.000	1.000	1.339E-53	266	1.000	1.000	O43819.pdb.gz	SCO2_HUMAN Protein SCO2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO2 PE=1 SV=3
2	AFDB:Q8VCL2	0.789	0.823	2.391E-42	255	0.778	0.812	Q8VCL2.pdb.gz	SCO2_MOUSE Protein SCO2 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Sco2 PE=1 SV=1
3	AFDB:Q9VMX4	0.656	0.693	2.065E-30	251	0.406	0.430	Q9VMX4.pdb.gz	Q9VMX4_DROME AT19154p OS=Drosophila melanogaster OX=7227 GN=Scox PE=1 SV=1
4	AFDB:O75880	0.663	0.592	4.534E-29	301	0.380	0.336	O75880.pdb.gz	SCO1_HUMAN Protein SCO1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO1 PE=1 SV=1
5	AFDB:Q5SUC9	0.690	0.649	1.029E-28	284	0.421	0.394	Q5SUC9.pdb.gz	SCO1_MOUSE Protein SCO1 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Sco1 PE=1 SV=1
6	AFDB:Q8VYP0	0.600	0.483	3.085E-25	334	0.338	0.269	Q8VYP0.pdb.gz	SCO11_ARATH Protein SCO1 homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HCC1 PE=1 SV=1
7	AFDB:A0A1D8PTX2	0.613	0.544	2.984E-24	301	0.331	0.292	A0A1D8PTX2.pdb.gz	A0A1D8PTX2_CANAL Cu-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SCO1 PE=3 SV=1
8	AFDB:O42899	0.702	0.710	1.637E-23	263	0.301	0.304	O42899.pdb.gz	SCO1_SCHPO Protein sco1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sco1 PE=3 SV=1
9	AFDB:Q38FS2	0.632	0.528	4.214E-23	323	0.320	0.263	Q38FS2.pdb.gz	Q38FS2_TRYB2 Electon transport protein SCO1/SCO2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1140 PE=3 SV=1
10	AFDB:P23833	0.651	0.593	6.977E-23	295	0.387	0.349	P23833.pdb.gz	SCO1_YEAST Protein SCO1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCO1 PE=1 SV=1
11	PDB:3iosA	0.398	0.726	5.123E-7	134	0.098	0.194	3iosA.pdb.gz
12	PDB:4k1fA	0.373	0.479	1.697E-6	198	0.102	0.136	4k1fA.pdb.gz
13	PDB:1xvwB	0.407	0.628	2.050E-6	160	0.105	0.175	1xvwB.pdb.gz
14	PDB:1qmvA	0.387	0.504	3.188E-6	197	0.086	0.117	1qmvA.pdb.gz
15	PDB:5b6mF	0.412	0.481	4.369E-6	223	0.090	0.108	5b6mF.pdb.gz
16	PDB:3tkpA	0.383	0.499	5.988E-6	197	0.105	0.142	3tkpA.pdb.gz
17	PDB:3ztlB	0.342	0.475	6.377E-6	183	0.090	0.131	3ztlB.pdb.gz
18	PDB:4af2A	0.411	0.600	6.792E-6	175	0.068	0.103	4af2A.pdb.gz
19	PDB:2z9sA	0.387	0.502	7.234E-6	197	0.079	0.107	2z9sA.pdb.gz
20	PDB:5b8aH	0.369	0.519	1.125E-5	177	0.079	0.119	5b8aH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43819	0.0	543	266	1.000	1.000	SCO2_HUMAN Protein SCO2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO2 PE=1 SV=3
2	Q8VCL2	2.45e-145	409	255	0.778	0.812	SCO2_MOUSE Protein SCO2 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Sco2 PE=1 SV=1
3	A0A1W2PQK0	8.70e-120	341	168	0.632	1.000	A0A1W2PQK0_HUMAN Synthesis of cytochrome C oxidase 2 (Fragment) OS=Homo sapiens OX=9606 GN=SCO2 PE=1 SV=2
4	Q9VMX4	1.27e-75	232	251	0.395	0.418	Q9VMX4_DROME AT19154p OS=Drosophila melanogaster OX=7227 GN=Scox PE=1 SV=1
5	O75880	1.57e-64	205	301	0.372	0.329	SCO1_HUMAN Protein SCO1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO1 PE=1 SV=1
6	Q5SUC9	1.70e-64	204	284	0.361	0.338	SCO1_MOUSE Protein SCO1 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Sco1 PE=1 SV=1
7	Q8VYP0	6.66e-50	169	334	0.305	0.243	SCO11_ARATH Protein SCO1 homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HCC1 PE=1 SV=1
8	P23833	1.53e-45	156	295	0.308	0.278	SCO1_YEAST Protein SCO1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCO1 PE=1 SV=1
9	O42899	1.24e-43	150	263	0.271	0.274	SCO1_SCHPO Protein sco1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sco1 PE=3 SV=1
10	P38072	9.16e-43	149	301	0.286	0.252	SCO2_YEAST Protein SCO2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCO2 PE=1 SV=1
11	A0A1D8PTX2	1.70e-42	149	301	0.289	0.256	A0A1D8PTX2_CANAL Cu-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SCO1 PE=3 SV=1
12	Q38EA7	4.36e-42	147	271	0.244	0.240	Q38EA7_TRYB2 Cytochrome c oxidase assembly factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0510 PE=3 SV=1
13	Q38FS2	3.43e-41	145	323	0.297	0.245	Q38FS2_TRYB2 Electon transport protein SCO1/SCO2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1140 PE=3 SV=1
14	Q89VB6	6.88e-35	126	196	0.229	0.311	Q89VB6_BRADU Blr1131 protein OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=blr1131 PE=1 SV=1
15	Q8LAL0	3.04e-28	110	276	0.199	0.192	SCO12_ARATH Protein SCO1 homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HCC2 PE=2 SV=1
16	Q52720	7.92e-26	103	221	0.233	0.281	SENC_RHOCB Protein SenC OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) OX=272942 GN=senC PE=3 SV=2
17	Q4GZ61	3.26e-22	95.5	301	0.199	0.176	Q4GZ61_TRYB2 Cytochrome c oxidase assembly factor, putative electron transport protein SCO1/2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1580 PE=3 SV=1
18	Q2GJ45	4.41e-20	87.8	209	0.169	0.215	Q2GJ45_ANAPZ Major surface protein 5 OS=Anaplasma phagocytophilum (strain HZ) OX=212042 GN=msp5 PE=3 SV=1
19	Q9LZX8	4.6	31.2	1793	0.060	0.009	BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana OX=3702 GN=BIG2 PE=2 SV=1
20	Q9C091	5.6	31.2	1923	0.105	0.015	GRB1L_HUMAN GREB1-like protein OS=Homo sapiens OX=9606 GN=GREB1L PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00578 AhpC-TSA	27	16.1	AhpC/TSA family
2	PF07729 FCD	1.6e+02	14.2	FCD domain
3	PF02630 SCO1-SenC	9.3e-45	163.4	SCO1/SenC
4	PF13905 Thioredoxin_8	2	20.1	Thioredoxin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000444433

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261070	0.964	Cytochrome c oxidase copper chaperone
2	9606.ENSP00000269305	0.961	Cellular tumor antigen p53
3	9606.ENSP00000307786	0.946	Cytochrome c
4	9606.ENSP00000355572	0.934	Cytochrome c oxidase assembly factor 6 homolog
5	9606.ENSP00000354876	0.918	Cytochrome c oxidase subunit 2
6	9606.ENSP00000299335	0.917	Cytochrome c oxidase assembly protein COX11, mitochondrial
7	9606.ENSP00000361042	0.907	Surfeit locus protein 1
8	9606.ENSP00000016171	0.894	Cytochrome c oxidase assembly protein COX15 homolog
9	9606.ENSP00000261643	0.882	Protoheme IX farnesyltransferase, mitochondrial
10	9606.ENSP00000179259	0.862	Fructose-2,6-bisphosphatase TIGAR
11	9606.ENSP00000406327	0.855	Cytochrome c oxidase protein 20 homolog
12	9606.ENSP00000354499	0.799	Cytochrome c oxidase subunit 1
13	9606.ENSP00000430598	0.751	Copper transport protein ATOX1
14	9606.ENSP00000379038	0.727	Thymidine phosphorylase
15	9606.ENSP00000342015	0.714	Cytochrome c oxidase assembly protein COX19
16	9606.ENSP00000402661	0.712	Plays a role in the early steps of cytochrome c oxidase subunit II (MT-CO2/COX2) maturation and is required for the stabilization of COX20 and the newly synthesized MT-CO2/COX2 protein.
17	9606.ENSP00000310447	0.687	Glutaminase liver isoform, mitochondrial
18	9606.ENSP00000354982	0.685	Cytochrome c oxidase subunit 3
19	9606.ENSP00000330730	0.684	Cytochrome c oxidase assembly factor 5
20	9606.ENSP00000258975	0.678	Translational activator of cytochrome c oxidase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0015035	0.999	protein-disulfide reductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0008535	0.991	respiratory chain complex IV assembly
GO:0007005	0.981	mitochondrion organization
GO:0033108	0.959	mitochondrial respiratory chain complex assembly
GO:0032502	0.920	developmental process
GO:0033617	0.911	mitochondrial cytochrome c oxidase assembly
GO:0032501	0.868	multicellular organismal process
GO:0048856	0.802	anatomical structure development
GO:0007275	0.717	multicellular organism development
GO:0008152	0.614	metabolic process
GO:0048731	0.537	system development
GO:0044237	0.521	cellular metabolic process
GO:0048880	0.399	sensory system development
GO:0150063	0.378	visual system development
GO:0007423	0.371	sensory organ development
GO:0001654	0.357	eye development
GO:0050789	0.326	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.991	intracellular organelle lumen
GO:0043232	0.953	intracellular non-membrane-bounded organelle
GO:0016020	0.952	membrane
GO:0031090	0.912	organelle membrane
GO:0005743	0.865	mitochondrial inner membrane
GO:0005759	0.533	mitochondrial matrix
GO:0099080	0.458	supramolecular complex
GO:0099512	0.437	supramolecular fiber
GO:0005654	0.378	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.-.-	0.999	Acting on a sulfur group of donors.

[back to server]