StarFunc result for job id O43820

User Input

>input (417 residues)
MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNALGIIAN
RGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGF
AGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARAL
MEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSA
LFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDD
LVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQR
CHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43820	1.000	1.000	1.030E-93	417	1.000	1.000	O43820.pdb.gz	HYAL3_HUMAN Hyaluronidase-3 OS=Homo sapiens OX=9606 GN=HYAL3 PE=1 SV=1
2	AFDB:Q8VEI3	0.939	0.950	5.562E-77	412	0.779	0.789	Q8VEI3.pdb.gz	HYAL3_MOUSE Hyaluronidase-3 OS=Mus musculus OX=10090 GN=Hyal3 PE=1 SV=2
3	AFDB:Q91ZJ9	0.882	0.798	3.080E-47	462	0.403	0.364	Q91ZJ9.pdb.gz	HYAL1_MOUSE Hyaluronidase-1 OS=Mus musculus OX=10090 GN=Hyal1 PE=1 SV=3
4	AFDB:O35632	0.858	0.759	4.961E-45	473	0.446	0.393	O35632.pdb.gz	HYAL2_MOUSE Hyaluronidase-2 OS=Mus musculus OX=10090 GN=Hyal2 PE=1 SV=2
5	AFDB:Q12891	0.865	0.765	5.924E-45	473	0.441	0.389	Q12891.pdb.gz	HYAL2_HUMAN Hyaluronidase-2 OS=Homo sapiens OX=9606 GN=HYAL2 PE=1 SV=4
6	AFDB:Q2M3T9	0.890	0.775	7.960E-45	481	0.381	0.331	Q2M3T9.pdb.gz	HYAL4_HUMAN Hyaluronidase-4 OS=Homo sapiens OX=9606 GN=HYAL4 PE=1 SV=2
7	AFDB:G3V6V8	0.897	0.781	1.355E-44	481	0.360	0.312	G3V6V8.pdb.gz	G3V6V8_RAT Hyaluronidase OS=Rattus norvegicus OX=10116 GN=Hyal4 PE=3 SV=1
8	AFDB:Q12794	0.866	0.832	2.921E-44	435	0.408	0.391	Q12794.pdb.gz	HYAL1_HUMAN Hyaluronidase-1 OS=Homo sapiens OX=9606 GN=HYAL1 PE=1 SV=2
9	PDB:2pe4A	0.858	0.858	4.114E-43	417	0.412	0.412	2pe4A.pdb.gz
10	AFDB:F1MZM9	0.819	0.624	2.315E-42	552	0.357	0.270	F1MZM9.pdb.gz	F1MZM9_BOVIN Hyaluronidase OS=Bos taurus OX=9913 GN=LOC509761 PE=3 SV=3
11	AFDB:Q812F3	0.814	0.649	1.076E-41	526	0.374	0.297	Q812F3.pdb.gz	HYAL5_MOUSE Hyaluronidase-5 OS=Mus musculus OX=10090 GN=Hyal5 PE=1 SV=1
12	PDB:3lxbB	0.265	0.275	9.578E-4	396	0.096	0.101	3lxbB.pdb.gz
13	PDB:3wh9A	0.286	0.329	1.078E-3	345	0.094	0.113	3wh9A.pdb.gz
14	PDB:1d9eD	0.238	0.319	2.944E-3	264	0.089	0.140	1d9eD.pdb.gz
15	PDB:4do4B	0.286	0.295	2.944E-3	400	0.096	0.100	4do4B.pdb.gz	Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
16	PDB:4ef8B	0.208	0.259	2.944E-3	314	0.072	0.096	4ef8B.pdb.gz	Target sites for the design of anti-trypanosomatid drugs based on the structure of dihydroorotate dehydrogenase.
17	PDB:1eyeA	0.176	0.246	3.313E-3	256	0.101	0.164	1eyeA.pdb.gz	Crystal structure of Mycobacterium tuberculosis 7,8-dihydropteroate synthase in complex with pterin monophosphate: new insight into the enzymatic mechanism and sulfa-drug action.
18	PDB:3odmC	0.251	0.215	3.729E-3	530	0.074	0.058	3odmC.pdb.gz	Structure of an archaeal-type phosphoenolpyruvate carboxylase sensitive to inhibition by aspartate.
19	PDB:4cnpA	0.203	0.291	4.452E-3	252	0.072	0.119	4cnpA.pdb.gz	Mechanistic Insight Into the Reaction Catalyzed by Type I Dehydroquinase
20	PDB:5dmlA	0.263	0.336	5.639E-3	292	0.098	0.140	5dmlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43820	0.0	852	417	1.000	1.000	HYAL3_HUMAN Hyaluronidase-3 OS=Homo sapiens OX=9606 GN=HYAL3 PE=1 SV=1
2	Q8VEI3	0.0	662	412	0.779	0.789	HYAL3_MOUSE Hyaluronidase-3 OS=Mus musculus OX=10090 GN=Hyal3 PE=1 SV=2
3	Q12891	1.12e-101	312	473	0.441	0.389	HYAL2_HUMAN Hyaluronidase-2 OS=Homo sapiens OX=9606 GN=HYAL2 PE=1 SV=4
4	O35632	1.15e-100	309	473	0.448	0.395	HYAL2_MOUSE Hyaluronidase-2 OS=Mus musculus OX=10090 GN=Hyal2 PE=1 SV=2
5	Q9Z2Q3	8.10e-99	305	473	0.434	0.383	HYAL2_RAT Hyaluronidase-2 OS=Rattus norvegicus OX=10116 GN=Hyal2 PE=2 SV=1
6	Q12794	1.37e-93	290	435	0.410	0.393	HYAL1_HUMAN Hyaluronidase-1 OS=Homo sapiens OX=9606 GN=HYAL1 PE=1 SV=2
7	Q05A56	8.93e-93	289	481	0.369	0.320	HYAL4_MOUSE Hyaluronidase-4 OS=Mus musculus OX=10090 GN=Hyal4 PE=2 SV=1
8	Q812F3	5.79e-92	288	526	0.367	0.291	HYAL5_MOUSE Hyaluronidase-5 OS=Mus musculus OX=10090 GN=Hyal5 PE=1 SV=1
9	Q2M3T9	1.30e-91	286	481	0.374	0.324	HYAL4_HUMAN Hyaluronidase-4 OS=Homo sapiens OX=9606 GN=HYAL4 PE=1 SV=2
10	Q91ZJ9	4.24e-89	279	462	0.396	0.357	HYAL1_MOUSE Hyaluronidase-1 OS=Mus musculus OX=10090 GN=Hyal1 PE=1 SV=3
11	G3V6V8	8.91e-88	276	481	0.350	0.304	G3V6V8_RAT Hyaluronidase OS=Rattus norvegicus OX=10116 GN=Hyal4 PE=3 SV=1
12	F1MZM9	3.28e-87	277	552	0.357	0.270	F1MZM9_BOVIN Hyaluronidase OS=Bos taurus OX=9913 GN=LOC509761 PE=3 SV=3
13	P38567	1.58e-86	274	509	0.379	0.310	HYALP_HUMAN Hyaluronidase PH-20 OS=Homo sapiens OX=9606 GN=SPAM1 PE=1 SV=1
14	P38568	1.75e-82	263	510	0.365	0.298	HYALP_MACFA Hyaluronidase PH-20 OS=Macaca fascicularis OX=9541 GN=SPAM1 PE=2 SV=1
15	P48794	2.94e-81	260	512	0.357	0.291	HYALP_MOUSE Hyaluronidase PH-20 OS=Mus musculus OX=10090 GN=Spam1 PE=1 SV=2
16	Q62803	2.89e-76	248	512	0.309	0.252	HYALP_RAT Hyaluronidase PH-20 OS=Rattus norvegicus OX=10116 GN=Spam1 PE=2 SV=1
17	P86100	1.07e-55	191	410	0.283	0.288	HYAL1_MESMA Hyaluronidase-1 OS=Mesobuthus martensii OX=34649 PE=1 SV=2
18	C0HKM3	9.83e-55	189	458	0.312	0.284	HYAL_CONPU Hyaluronidase conohyal-P1 OS=Conus purpurascens OX=41690 PE=1 SV=1
19	Q76HN0	3.89e-51	174	266	0.213	0.335	Q76HN0_RAT Hyaluronidase (Fragment) OS=Rattus norvegicus OX=10116 GN=Hyal4 PE=2 SV=1
20	G5ECE8	2.49e-48	172	458	0.273	0.249	G5ECE8_CAEEL Hyaluronidase OS=Caenorhabditis elegans OX=6239 GN=chhy-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	4.2e+02	12.7	EGF-like domain
2	PF07974 EGF_2	6.6	18.5	EGF-like domain
3	PF01630 Glyco_hydro_56	3.4e-119	409.3	Hyaluronidase
4	PF02073 Peptidase_M29	3.4e+02	11.4	Thermophilic metalloprotease (M29)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337425

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302728	0.915	Beta-glucuronidase
2	9606.ENSP00000247933	0.908	Alpha-L-iduronidase
3	9606.ENSP00000262013	0.907	C-Jun-amino-terminal kinase-interacting protein 4
4	9606.ENSP00000264914	0.906	Arylsulfatase B
5	9606.ENSP00000304440	0.563	Hyaluronan synthase 3
6	9606.ENSP00000268122	0.530	Ammonium transporter Rh type C
7	9606.ENSP00000222115	0.506	Hyaluronan synthase 1
8	9606.ENSP00000306991	0.504	Hyaluronan synthase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004415	1.000	hyalurononglucosaminidase activity
GO:0005515	0.990	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.991	organic substance metabolic process
GO:0009987	0.968	cellular process
GO:1903510	0.940	mucopolysaccharide metabolic process
GO:0009057	0.921	macromolecule catabolic process
GO:0006027	0.901	glycosaminoglycan catabolic process
GO:0050896	0.895	response to stimulus
GO:0032501	0.813	multicellular organismal process
GO:0044419	0.772	biological process involved in interspecies interaction between organisms
GO:0050789	0.608	regulation of biological process
GO:0050794	0.522	regulation of cellular process
GO:0044238	0.486	primary metabolic process
GO:0051707	0.445	response to other organism
GO:0048856	0.427	anatomical structure development
GO:0007275	0.416	multicellular organism development
GO:0048731	0.363	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0031982	0.998	vesicle
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0031410	0.994	cytoplasmic vesicle
GO:0005764	0.936	lysosome
GO:0005576	0.898	extracellular region
GO:0005615	0.884	extracellular space
GO:0012505	0.842	endomembrane system
GO:0016020	0.828	membrane
GO:0043230	0.486	extracellular organelle
GO:1903561	0.484	extracellular vesicle
GO:0030141	0.381	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.35	1.000	hyaluronoglucosaminidase.

[back to server]