StarFunc result for job id O43823

User Input

>input (692 residues)
MDQGYGGYGAWSAGPANTQGAYGTGVASWQGYENYNYYGAQNTSVTTGATYSYGPASWEA
AKANDGGLAAGAPAMHMASYGPEPCTDNSDSLIAKINQRLDMMSKEGGRGGSGGGGEGIQ
DRESSFRFQPFESYDSRPCLPEHNPYRPSYSYDYEFDLGSDRNGSFGGQYSECRDPARER
GSLDGFMRGRGQGRFQDRSNPGTFMRSDPFVPPAASSEPLSTPWNELNYVGGRGLGGPSP
SRPPPSLFSQSMAPDYGVMGMQGAGGYDSTMPYGCGRSQPRMRDRDRPKRRGFDRFGPDG
TGRKRKQFQLYEEPDTKLARVDSEGDFSENDDAAGDFRSGDEEFKGEDELCDSGRQRGEK
EDEDEDVKKRREKQRRRDRTRDRAADRIQFACSVCKFRSFDDEEIQKHLQSKFHKETLRF
ISTKLPDKTVEFLQEYIVNRNKKIEKRRQELMEKETAKPKPDPFKGIGQEHFFKKIEAAH
CLACDMLIPAQPQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYL
KGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESS
GEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEA
ESAQTRVAPAPAAADAEVEQTDAESKDAVPTE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43823	1.000	1.000	7.745E-95	692	1.000	1.000	O43823.pdb.gz	AKAP8_HUMAN A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1
2	AFDB:Q63014	0.407	0.410	3.181E-75	687	0.795	0.801	Q63014.pdb.gz	AKAP8_RAT A-kinase anchor protein 8 OS=Rattus norvegicus OX=10116 GN=Akap8 PE=1 SV=1
3	AFDB:Q5VK71	0.343	0.341	3.368E-75	698	0.829	0.822	Q5VK71.pdb.gz	AKAP8_CANLF A-kinase anchor protein 8 OS=Canis lupus familiaris OX=9615 GN=AKAP8 PE=1 SV=1
4	AFDB:Q9ULX6	0.259	0.276	1.642E-26	646	0.286	0.307	Q9ULX6.pdb.gz	AKP8L_HUMAN A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4
5	AFDB:Q5SYW2	0.057	0.047	9.793E-4	870	0.127	0.101	Q5SYW2.pdb.gz	Q5SYW2_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
6	AFDB:Q9VED3	0.076	0.052	7.170E-3	1186	0.107	0.062	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
7	AFDB:Q9VMA7	0.052	0.032	2.367E-2	1430	0.129	0.062	Q9VMA7.pdb.gz	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2
8	AFDB:Q54XQ2	0.070	0.051	2.653E-2	1125	0.117	0.072	Q54XQ2.pdb.gz	RCKA_DICDI RGS domain-containing serine/threonine-protein kinase A OS=Dictyostelium discoideum OX=44689 GN=rckA PE=1 SV=1
9	AFDB:Q8I398	0.059	0.025	6.226E-2	2112	0.129	0.042	Q8I398.pdb.gz	Q8I398_PLAF7 Nucleoporin NUP221, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905100 PE=4 SV=1
10	AFDB:Q9VUQ9	0.070	0.037	6.590E-2	2139	0.155	0.050	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
11	PDB:7rroA1	0.074	0.117	3.393	396	0.058	0.101	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:7wkwB	0.045	0.075	4.024	377	0.022	0.040	7wkwB.pdb.gz	Structures and mechanisms of the Arabidopsis auxin transporter PIN3.
13	PDB:7rroA3	0.073	0.134	4.508	334	0.052	0.108	7rroA3.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
14	PDB:7vciU	0.060	0.052	5.052	820	0.043	0.037	7vciU.pdb.gz
15	PDB:7pntL	0.055	0.148	5.347	176	0.033	0.131	7pntL.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
16	PDB:5o9zQ	0.068	0.397	5.992	75	0.022	0.200	5o9zQ.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
17	PDB:3kwoA	0.050	0.146	7.106	149	0.030	0.141	3kwoA.pdb.gz	Crystal Structure of Putative Bacterioferritin from Campylobacter jejuni
18	PDB:5n9jE	0.040	0.114	7.962	201	0.043	0.149	5n9jE.pdb.gz
19	PDB:7knuE	0.038	0.185	7.962	115	0.014	0.087	7knuE.pdb.gz	Structure and dynamics of the CGRP receptor in apo and peptide-bound forms.
20	PDB:6o8cA	0.050	0.054	8.428	636	0.029	0.031	6o8cA.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43823	0.0	1427	692	1.000	1.000	AKAP8_HUMAN A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1
2	Q5VK71	0.0	1031	698	0.825	0.818	AKAP8_CANLF A-kinase anchor protein 8 OS=Canis lupus familiaris OX=9615 GN=AKAP8 PE=1 SV=1
3	Q63014	0.0	1018	687	0.785	0.790	AKAP8_RAT A-kinase anchor protein 8 OS=Rattus norvegicus OX=10116 GN=Akap8 PE=1 SV=1
4	Q9DBR0	0.0	1008	687	0.779	0.785	AKAP8_MOUSE A-kinase anchor protein 8 OS=Mus musculus OX=10090 GN=Akap8 PE=1 SV=1
5	Q9ULX6	1.27e-75	257	646	0.266	0.285	AKP8L_HUMAN A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4
6	Q9R0L7	2.25e-72	248	642	0.262	0.282	AKP8L_MOUSE A-kinase anchor protein 8-like OS=Mus musculus OX=10090 GN=Akap8l PE=1 SV=1
7	Q5BKZ1	1.64e-28	123	582	0.092	0.110	ZN326_HUMAN DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=2
8	A0A0A0MRN4	4.83e-28	120	493	0.092	0.130	A0A0A0MRN4_HUMAN Zinc finger protein 326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=1
9	Q02224	0.035	40.0	2701	0.046	0.012	CENPE_HUMAN Centromere-associated protein E OS=Homo sapiens OX=9606 GN=CENPE PE=1 SV=2
10	Q8IDX6	1.1	35.0	3130	0.058	0.013	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
11	O88291	1.7	34.3	580	0.039	0.047	ZN326_MOUSE DBIRD complex subunit ZNF326 OS=Mus musculus OX=10090 GN=Znf326 PE=1 SV=1
12	Q6MWY2	2.3	34.3	2523	0.036	0.010	PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=PPE54 PE=3 SV=1
13	E9PG18	3.6	33.5	1998	0.038	0.013	E9PG18_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
14	A0A0A0MT39	3.7	33.5	1962	0.038	0.013	A0A0A0MT39_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
15	H9KVD2	3.8	33.5	2016	0.038	0.013	H9KVD2_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
16	E9PHB6	3.9	33.5	1983	0.038	0.013	E9PHB6_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
17	Q14524	3.9	33.5	2016	0.038	0.013	SCN5A_HUMAN Sodium channel protein type 5 subunit alpha OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=2
18	K4DIA1	4.0	33.5	1962	0.038	0.013	K4DIA1_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
19	P08048	5.3	32.7	801	0.042	0.036	ZFY_HUMAN Zinc finger Y-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFY PE=1 SV=3
20	P52739	6.9	32.3	623	0.043	0.048	ZN131_HUMAN Zinc finger protein 131 OS=Homo sapiens OX=9606 GN=ZNF131 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04988 AKAP95	1.4e-51	185.8	A-kinase anchoring protein 95 (AKAP95)
2	PF12756 zf-C2H2_2	17	17.2	C2H2 type zinc-finger (2 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269701

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265717	0.949	cAMP-dependent protein kinase type II-beta regulatory subunit
2	9606.ENSP00000325017	0.948	Condensin complex subunit 1
3	9606.ENSP00000265563	0.946	cAMP-dependent protein kinase type II-alpha regulatory subunit
4	9606.ENSP00000359719	0.943	cAMP-dependent protein kinase catalytic subunit beta
5	9606.ENSP00000366488	0.902	cAMP-dependent protein kinase catalytic subunit gamma
6	9606.ENSP00000417963	0.901	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
7	9606.ENSP00000323867	0.900	5'-AMP-activated protein kinase subunit gamma-1
8	9606.ENSP00000363431	0.900	Neuropeptide Y receptor type 4
9	9606.ENSP00000380702	0.818	c-Myc-binding protein
10	9606.ENSP00000362082	0.807	G1/S-specific cyclin-D3
11	9606.ENSP00000225792	0.797	Probable ATP-dependent RNA helicase DDX5
12	9606.ENSP00000345837	0.778	Protein dpy-30 homolog
13	9606.ENSP00000478212	0.764	A-kinase anchor protein 1, mitochondrial
14	9606.ENSP00000404782	0.763	A-kinase anchor protein 2
15	9606.ENSP00000378207	0.750	A-kinase anchor protein 5
16	9606.ENSP00000262653	0.738	Protein CBFA2T2
17	9606.ENSP00000311032	0.728	Caspase-3
18	9606.ENSP00000354718	0.720	A-kinase anchor protein 13
19	9606.ENSP00000262643	0.707	G1/S-specific cyclin-E1
20	9606.ENSP00000318297	0.703	RuvB-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003676	0.998	nucleic acid binding
GO:0034237	0.997	protein kinase A regulatory subunit binding
GO:0019899	0.990	enzyme binding
GO:0003723	0.980	RNA binding
GO:0042826	0.941	histone deacetylase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.997	regulation of biological process
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.982	response to stimulus
GO:0051716	0.955	cellular response to stimulus
GO:0010604	0.955	positive regulation of macromolecule metabolic process
GO:0051171	0.922	regulation of nitrogen compound metabolic process
GO:0080090	0.919	regulation of primary metabolic process
GO:0007154	0.875	cell communication
GO:0023052	0.845	signaling
GO:0051246	0.843	regulation of protein metabolic process
GO:0007165	0.826	signal transduction
GO:0051173	0.818	positive regulation of nitrogen compound metabolic process
GO:0007049	0.773	cell cycle
GO:0031399	0.721	regulation of protein modification process
GO:0000278	0.714	mitotic cell cycle
GO:0031063	0.687	regulation of histone deacetylation
GO:0022402	0.561	cell cycle process
GO:0031323	0.467	regulation of cellular metabolic process
GO:0010468	0.454	regulation of gene expression
GO:0071840	0.433	cellular component organization or biogenesis
GO:0048522	0.424	positive regulation of cellular process
GO:0016043	0.402	cellular component organization
GO:0051247	0.369	positive regulation of protein metabolic process
GO:0019219	0.350	regulation of nucleobase-containing compound metabolic process
GO:0008152	0.313	metabolic process
GO:0044770	0.311	cell cycle phase transition
GO:0031401	0.310	positive regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005654	0.995	nucleoplasm
GO:0016020	0.992	membrane
GO:0005737	0.964	cytoplasm
GO:0032991	0.939	protein-containing complex
GO:0005730	0.739	nucleolus
GO:0005829	0.600	cytosol
GO:0005886	0.307	plasma membrane
GO:0016363	0.301	nuclear matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]