StarFunc result for job id O43824

User Input

>input (516 residues)
MWALRAAVRPGLRLSRVGRGRSAPRAAAPSCPARALAAVGRRSPGNLEGPWGGGRGLRAD
GGRSRTGDDEEEPEDADENAEEELLRGEPLLPAGTQRVCLVHPDVKWGPGKSQMTRAEWQ
VAEATALVHTLDGWSVVQTMVVSTKTPDRKLIFGKGNFEHLTEKIRGSPDITCVFLNVER
MAAPTKKELEAAWGVEVFDRFTVVLHIFRCNARTKEARLQVALAEMPLHRSNLKRDVAHL
YRGVGSRYIMGSGESFMQLQQRLLREKEAKIRKALDRLRKKRHLLRRQRTRREFPVISVV
GYTNCGKTTLIKALTGDAAIQPRDQLFATLDVTAHAGTLPSRMTVLYVDTIGFLSQLPHG
LIESFSATLEDVAHSDLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKV
DLVPGYSPTEPNVVPVSALRGHGLQELKAELDAAVLKATGRQILTLRVRLAGAQLSWLYK
EATVQEVDVIPEDGAADVRVIISNSAYGKFRKLFPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43824	1.000	1.000	4.479E-97	516	1.000	1.000	O43824.pdb.gz	GTPB6_HUMAN Putative GTP-binding protein 6 OS=Homo sapiens OX=9606 GN=GTPBP6 PE=1 SV=4
2	PDB:7of4C	0.782	0.950	9.155E-69	422	0.818	1.000	7of4C.pdb.gz	Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
3	AFDB:Q9FJM0	0.698	0.669	4.281E-36	540	0.277	0.265	Q9FJM0.pdb.gz	Q9FJM0_ARATH GTP binding protein-like OS=Arabidopsis thaliana OX=3702 GN=HFLX PE=1 SV=1
4	AFDB:O33230	0.681	0.708	6.843E-35	495	0.248	0.259	O33230.pdb.gz	O33230_MYCTU GTPase HflX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hflX PE=1 SV=1
5	AFDB:P25519	0.688	0.821	2.967E-33	426	0.234	0.284	P25519.pdb.gz	HFLX_ECOLI GTPase HflX OS=Escherichia coli (strain K12) OX=83333 GN=hflX PE=1 SV=3
6	PDB:5ady6	0.700	0.836	4.094E-29	426	0.234	0.284	5ady6.pdb.gz	Hflx is a Ribosome Splitting Factor Rescuing Stalled Ribosomes Under Stress Conditions
7	AFDB:B5X565	0.230	0.182	5.652E-10	663	0.140	0.109	B5X565.pdb.gz	B5X565_ARATH GTPase Der OS=Arabidopsis thaliana OX=3702 GN=EMB2738 PE=1 SV=1
8	AFDB:Q969Y2	0.265	0.276	4.910E-9	492	0.134	0.140	Q969Y2.pdb.gz	GTPB3_HUMAN tRNA modification GTPase GTPBP3, mitochondrial OS=Homo sapiens OX=9606 GN=GTPBP3 PE=1 SV=2
9	PDB:7pubIA	0.247	0.187	3.809E-8	693	0.099	0.074	7pubIA.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
10	PDB:6n8jb	0.234	0.193	1.092E-7	647	0.116	0.093	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
11	PDB:7po27	0.222	0.202	1.523E-7	571	0.095	0.086	7po27.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
12	PDB:6elzb	0.236	0.281	2.651E-7	421	0.101	0.124	6elzb.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
13	PDB:7unvx	0.233	0.204	4.131E-7	593	0.099	0.086	7unvx.pdb.gz	Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
14	PDB:7o9kG	0.254	0.378	6.803E-7	337	0.076	0.116	7o9kG.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
15	PDB:5c2kA	0.243	0.320	8.976E-7	382	0.060	0.081	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:7ohyb	0.236	0.314	1.060E-6	375	0.095	0.131	7ohyb.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
17	AFDB:Q9LUS2	0.192	0.097	1.795E-5	1089	0.132	0.062	Q9LUS2.pdb.gz	TC120_ARATH Translocase of chloroplast 120, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC120 PE=1 SV=1
18	AFDB:Q9SLF3	0.188	0.087	2.956E-5	1206	0.134	0.057	Q9SLF3.pdb.gz	TC132_ARATH Translocase of chloroplast 132, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC132 PE=1 SV=1
19	AFDB:Q5SSG5	0.257	0.581	3.491E-5	203	0.054	0.138	Q5SSG5.pdb.gz	RSLAB_MOUSE Ras-like protein family member 10B OS=Mus musculus OX=10090 GN=Rasl10b PE=1 SV=1
20	AFDB:Q9BSW2	0.243	0.176	7.177E-5	731	0.060	0.042	Q9BSW2.pdb.gz	EFC4B_HUMAN EF-hand calcium-binding domain-containing protein 4B OS=Homo sapiens OX=9606 GN=CRACR2A PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43824	0.0	1049	516	1.000	1.000	GTPB6_HUMAN Putative GTP-binding protein 6 OS=Homo sapiens OX=9606 GN=GTPBP6 PE=1 SV=4
2	Q9FJM0	1.54e-42	161	540	0.225	0.215	Q9FJM0_ARATH GTP binding protein-like OS=Arabidopsis thaliana OX=3702 GN=HFLX PE=1 SV=1
3	P25519	3.30e-40	152	426	0.227	0.275	HFLX_ECOLI GTPase HflX OS=Escherichia coli (strain K12) OX=83333 GN=hflX PE=1 SV=3
4	O33230	2.57e-31	129	495	0.203	0.212	O33230_MYCTU GTPase HflX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hflX PE=1 SV=1
5	Q97IJ0	4.76e-04	45.1	411	0.095	0.119	Q97IJ0_CLOAB Predicted GTPase with uncharacterized domain, ortholog of T.maritima (4980952) OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_C1651 PE=1 SV=1
6	Q8VZ74	0.082	37.7	427	0.083	0.101	ERA_ARATH GTPase ERA-like, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g66470 PE=2 SV=1
7	Q8R420	0.096	38.1	1704	0.076	0.023	ABCA3_MOUSE Phospholipid-transporting ATPase ABCA3 OS=Mus musculus OX=10090 GN=Abca3 PE=1 SV=3
8	P38746	0.10	37.7	405	0.060	0.077	YLF2_YEAST Obg-like ATPase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLF2 PE=1 SV=1
9	A0A0G2K1Q8	0.12	37.7	1704	0.076	0.023	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
10	A0A0B4KHD0	0.22	36.6	740	0.072	0.050	A0A0B4KHD0_DROME Alpha2-adrenergic-like octopamine receptor, isoform B OS=Drosophila melanogaster OX=7227 GN=Octalpha2R PE=3 SV=1
11	Q9DA97	0.23	36.6	430	0.081	0.098	SEP14_MOUSE Septin-14 OS=Mus musculus OX=10090 GN=Septin14 PE=1 SV=3
12	A0A0H2UP48	0.32	35.4	213	0.045	0.108	A0A0H2UP48_STRPN ABC transporter, ATP-binding protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0687 PE=1 SV=1
13	Q5SM23	0.49	35.0	301	0.097	0.166	ERA_THET8 GTPase Era OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=era PE=1 SV=1
14	Q92989	0.51	35.4	425	0.056	0.068	CLP1_HUMAN Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Homo sapiens OX=9606 GN=CLP1 PE=1 SV=1
15	Q99LI9	0.51	35.4	425	0.056	0.068	CLP1_MOUSE Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Mus musculus OX=10090 GN=Clp1 PE=1 SV=1
16	K7UTH7	0.52	35.4	416	0.083	0.103	ERA1_MAIZE GTPase ERA1, chloroplastic OS=Zea mays OX=4577 GN=ERA1 PE=2 SV=1
17	E9PL17	0.53	35.4	436	0.056	0.067	E9PL17_HUMAN Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Homo sapiens OX=9606 GN=CLP1 PE=1 SV=1
18	P42182	0.60	35.0	301	0.078	0.133	ERA_BACSU GTPase Era OS=Bacillus subtilis (strain 168) OX=224308 GN=era PE=1 SV=1
19	Q9SJF1	0.63	35.0	589	0.066	0.058	LSG12_ARATH GTPase LSG1-2 OS=Arabidopsis thaliana OX=3702 GN=LSG1-2 PE=1 SV=1
20	Q91YJ5	0.65	35.0	727	0.093	0.066	IF2M_MOUSE Translation initiation factor IF-2, mitochondrial OS=Mus musculus OX=10090 GN=Mtif2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	3.9e+02	12.5	AAA domain
2	PF13191 AAA_16	42	16.0	AAA ATPase domain
3	PF00005 ABC_tran	2.5e+02	13.6	ABC transporter
4	PF19993 DO-GTPase2	3.7e+02	12.2	Double-GTPase 2
5	PF00350 Dynamin_N	59	15.2	Dynamin family
6	PF02421 FeoB_N	1.2	20.1	Ferrous iron transport protein B
7	PF16360 GTP-bdg_M	1.5e-15	68.8	GTP-binding GTPase Middle Region
8	PF13167 GTP-bdg_N	1e-09	50.3	GTP-binding GTPase N-terminal
9	PF00009 GTP_EFTU	5.4e+02	11.5	Elongation factor Tu GTP binding domain
10	PF19275 HflX_C	1.9	19.9	HflX C-terminal domain
11	PF01926 MMR_HSR1	2.6e-10	51.8	50S ribosome-binding GTPase
12	PF03205 MobB	1e+02	14.2	Molybdopterin guanine dinucleotide synthesis protein B
13	PF10662 PduV-EutP	2.1e+02	13.1	Ethanolamine utilisation - propanediol utilisation
14	PF05621 TniB	55	14.6	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316598

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334113	0.893	Dehydrogenase/reductase SDR family member on chromosome X
2	9606.ENSP00000371073	0.802	PI-PLC X domain-containing protein 1
3	9606.ENSP00000354040	0.773	Nucleolar GTP-binding protein 1
4	9606.ENSP00000362457	0.771	Melanoma-associated antigen E2
5	9606.ENSP00000375080	0.722	Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
6	9606.ENSP00000370718	0.710	N-acetylserotonin O-methyltransferase-like protein
7	9606.ENSP00000357823	0.668	Mitochondrial ribosomal protein L9
8	9606.ENSP00000370990	0.650	Short stature homeobox protein
9	9606.ENSP00000370808	0.613	ADP/ATP translocase 3
10	9606.ENSP00000321810	0.608	tRNA dimethylallyltransferase
11	9606.ENSP00000324827	0.606	A-kinase anchor protein 17A
12	9606.ENSP00000362576	0.590	Tyrosine--tRNA ligase, cytoplasmic
13	9606.ENSP00000351644	0.575	tRNA modification GTPase GTPBP3, mitochondrial
14	9606.ENSP00000370555	0.575	Glycogenin-2
15	9606.ENSP00000262848	0.566	cAMP-dependent protein kinase catalytic subunit PRKX
16	9606.ENSP00000399324	0.559	Fibroblast growth factor 16
17	9606.ENSP00000363676	0.545	60S ribosomal protein L11
18	9606.ENSP00000370697	0.543	P2Y purinoceptor 8
19	9606.ENSP00000311984	0.537	ATP-dependent (S)-NAD(P)H-hydrate dehydratase
20	9606.ENSP00000354912	0.537	Melanoma-associated antigen E1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005525	1.000	GTP binding
GO:0005515	0.833	protein binding
GO:0003824	0.753	catalytic activity
GO:0003676	0.649	nucleic acid binding
GO:0003723	0.403	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0034641	0.984	cellular nitrogen compound metabolic process
GO:0043170	0.934	macromolecule metabolic process
GO:1901564	0.907	organonitrogen compound metabolic process
GO:0010467	0.653	gene expression
GO:0019538	0.640	protein metabolic process
GO:0065007	0.633	biological regulation
GO:0044260	0.609	cellular macromolecule metabolic process
GO:0050794	0.539	regulation of cellular process
GO:0006412	0.509	translation
GO:0071840	0.353	cellular component organization or biogenesis
GO:0050896	0.313	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0016020	0.990	membrane
GO:0070013	0.942	intracellular organelle lumen
GO:0031090	0.609	organelle membrane
GO:0031975	0.584	envelope
GO:0031967	0.541	organelle envelope
GO:0005759	0.449	mitochondrial matrix
GO:0005743	0.383	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]