StarFunc result for job id O43825

User Input

>input (422 residues)
MLQWRRRHCCFAKMTWNAKRSLFRTHLIGVLSLVFLFAMFLFFNHHDWLPGRAGFKENPV
TYTFRGFRSTKSETNHSSLRNIWKETVPQTLRPQTATNSNNTDLSPQGVTGLENTLSANG
SIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGNESLA
PGIQITRIFLLGLSIKLNGYLQRAILEESRQYHDIIQQEYLDTYYNLTIKTLMGMNWVAT
YCPHIPYVMKTDSDMFVNTEYLINKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPP
DLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYVGICLAKLRIDPVPPPN
EFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRK
LH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43825	1.000	1.000	2.853E-86	422	1.000	1.000	O43825.pdb.gz	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
2	AFDB:O54904	0.623	0.805	9.072E-41	326	0.363	0.469	O54904.pdb.gz	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
3	AFDB:Q9Y2C3	0.617	0.835	8.304E-33	310	0.256	0.348	Q9Y2C3.pdb.gz	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
4	AFDB:Q9JI67	0.613	0.832	3.788E-32	308	0.277	0.380	Q9JI67.pdb.gz	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
5	AFDB:O75752	0.588	0.744	5.817E-31	331	0.235	0.299	O75752.pdb.gz	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
6	AFDB:Q9BYG0	0.611	0.680	2.497E-30	378	0.227	0.254	Q9BYG0.pdb.gz	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
7	AFDB:Q99NB2	0.613	0.684	4.312E-30	377	0.225	0.252	Q99NB2.pdb.gz	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
8	AFDB:Q6ZMB0	0.587	0.644	2.221E-29	384	0.258	0.284	Q6ZMB0.pdb.gz	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
9	AFDB:Q8NFL0	0.591	0.619	3.396E-29	401	0.258	0.272	Q8NFL0.pdb.gz	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
10	AFDB:Q8K0J2	0.597	0.634	6.232E-29	397	0.249	0.264	Q8K0J2.pdb.gz	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
11	PDB:7jhiC	0.594	0.751	9.020E-29	331	0.209	0.266	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
12	PDB:4y63A	0.287	0.404	5.086E-6	282	0.062	0.092	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
13	PDB:6fxrA	0.293	0.192	8.820E-5	700	0.076	0.046	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
14	PDB:1ll0B	0.289	0.413	2.330E-4	267	0.066	0.105	1ll0B.pdb.gz
15	PDB:8cvzI	0.296	0.424	4.275E-4	267	0.085	0.135	8cvzI.pdb.gz
16	PDB:2gamC	0.405	0.449	6.538E-4	374	0.095	0.107	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
17	PDB:7d72A	0.240	0.247	6.947E-4	407	0.085	0.088	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
18	PDB:4fixA	0.311	0.220	7.382E-4	629	0.069	0.046	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
19	PDB:4cvhA	0.280	0.297	1.000E-3	391	0.076	0.082	4cvhA.pdb.gz	Human Ispd is a Cytidyltransferase Required for Dystroglycan O-Mannosylation.
20	PDB:5vcmB	0.294	0.333	1.129E-3	358	0.076	0.089	5vcmB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43825	0.0	887	422	1.000	1.000	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
2	O54905	0.0	846	422	0.945	0.945	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
3	O54904	3.93e-99	300	326	0.339	0.439	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
4	Q9Y5Z6	3.93e-99	300	326	0.339	0.439	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
5	Q9JI67	2.95e-73	233	308	0.280	0.383	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
6	Q9Y2C3	2.40e-69	223	310	0.256	0.348	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
7	Q920V1	2.52e-56	190	331	0.225	0.287	B3GL1_MOUSE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=B3galnt1 PE=2 SV=2
8	O75752	4.29e-55	187	331	0.227	0.290	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
9	Q9BYG0	2.80e-50	176	378	0.218	0.243	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
10	Q99NB2	1.06e-49	174	377	0.220	0.247	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
11	Q8BGY6	1.39e-47	169	376	0.213	0.239	B3GN5_MOUSE Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
12	Q6ZMB0	5.29e-46	165	384	0.244	0.268	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
13	Q8K0J2	3.53e-45	163	397	0.209	0.222	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
14	Q9NY97	4.44e-45	162	397	0.213	0.227	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
15	Q8NFL0	9.79e-45	162	401	0.209	0.219	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
16	Q9Z222	2.11e-42	155	397	0.201	0.214	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
17	Q9C0J1	2.01e-38	144	378	0.199	0.222	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
18	Q9Y2A9	2.30e-34	133	372	0.192	0.218	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
19	Q9VLS8	5.35e-33	132	585	0.199	0.144	Q9VLS8_DROME LD29807p OS=Drosophila melanogaster OX=7227 GN=GalT4 PE=1 SV=2
20	Q7Z7M8	3.59e-31	125	397	0.187	0.199	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19341 B3GALT2_N	2.5e-27	106.8	Beta-1,3-galactosyltransferase 2 N-terminus
2	PF01762 Galactosyl_T	4.4e-63	224.2	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356404

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369055	0.962	Beta-1,4-galactosyltransferase 1
2	9606.ENSP00000420161	0.939	Beta-1,4-galactosyltransferase 4
3	9606.ENSP00000310696	0.935	Beta-1,4-galactosyltransferase 2
4	9606.ENSP00000312021	0.929	Galactoside 2-alpha-L-fucosyltransferase 1
5	9606.ENSP00000480428	0.917	Beta-1,4-galactosyltransferase 3
6	9606.ENSP00000305603	0.916	Galactoside 3(4)-L-fucosyltransferase
7	9606.ENSP00000436047	0.916	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
8	9606.ENSP00000387498	0.915	Galactoside 2-alpha-L-fucosyltransferase 2
9	9606.ENSP00000316173	0.905	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
10	9606.ENSP00000381699	0.823	Beta-1,3-galactosyltransferase 5
11	9606.ENSP00000376456	0.817	Beta-1,3-galactosyltransferase 1
12	9606.ENSP00000363746	0.764	WD repeat-containing protein 46
13	9606.ENSP00000384794	0.741	Lactosylceramide 4-alpha-galactosyltransferase
14	9606.ENSP00000457788	0.708	Alpha-mannosidase 2C1
15	9606.ENSP00000035307	0.705	Chondroitin sulfate glucuronyltransferase
16	9606.ENSP00000363638	0.705	Acyl-protein thioesterase 2
17	9606.ENSP00000284031	0.667	N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
18	9606.ENSP00000336733	0.667	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
19	9606.ENSP00000387822	0.649	Bromodomain testis-specific protein
20	9606.ENSP00000238714	0.630	Poly(A) polymerase gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008499	1.000	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity
GO:0005515	0.562	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005975	0.996	carbohydrate metabolic process
GO:1901576	0.995	organic substance biosynthetic process
GO:0009312	0.992	oligosaccharide biosynthetic process
GO:0044237	0.989	cellular metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:1901564	0.982	organonitrogen compound metabolic process
GO:0044249	0.975	cellular biosynthetic process
GO:1901135	0.974	carbohydrate derivative metabolic process
GO:0043170	0.953	macromolecule metabolic process
GO:1901566	0.951	organonitrogen compound biosynthetic process
GO:1901137	0.939	carbohydrate derivative biosynthetic process
GO:0019538	0.911	protein metabolic process
GO:0009059	0.902	macromolecule biosynthetic process
GO:0044260	0.876	cellular macromolecule metabolic process
GO:0009100	0.859	glycoprotein metabolic process
GO:0036211	0.849	protein modification process
GO:0070085	0.846	glycosylation
GO:0034645	0.828	cellular macromolecule biosynthetic process
GO:0009101	0.820	glycoprotein biosynthetic process
GO:0006486	0.807	protein glycosylation
GO:0006643	0.775	membrane lipid metabolic process
GO:0006664	0.550	glycolipid metabolic process
GO:0006672	0.499	ceramide metabolic process
GO:0009247	0.378	glycolipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]