StarFunc result for job id O43826

User Input

>input (429 residues)
MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAY
AISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTVPVFAALWFLNGLAQGLGWPP
CGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQSYSWRSTLALSGALCVVVS
FLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWVLSTGYLVVFGVK
TCCTDWGQFFLIQEKGQSALVGSSYMSALEVGGLVGSIAAGYLSDRAMAKAGLSNYGNPR
HGLLLFMMAGMTVSMYLFRVTVTSDSPKLWILVLGAVFGFSSYGPIALFGVIANESAPPN
LCGTSHAIVGLMANVGGFLAGLPFSTIAKHYSWSTAFWVAEVICAASTAAFFLLRNIRTK
MGRVSKKAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43826	1.000	1.000	7.751E-58	429	1.000	1.000	O43826.pdb.gz	G6PT1_HUMAN Glucose-6-phosphate exchanger SLC37A4 OS=Homo sapiens OX=9606 GN=SLC37A4 PE=1 SV=1
2	AFDB:A0A0G2JTY3	0.992	0.946	3.932E-53	450	0.928	0.884	A0A0G2JTY3.pdb.gz	A0A0G2JTY3_RAT Solute carrier family 37 member 4 OS=Rattus norvegicus OX=10116 GN=Slc37a4 PE=1 SV=2
3	AFDB:A0A1L1SUI3	0.985	0.939	1.041E-52	450	0.928	0.884	A0A1L1SUI3.pdb.gz	A0A1L1SUI3_MOUSE Solute carrier family 37 (glucose-6-phosphate transporter), member 4 OS=Mus musculus OX=10090 GN=Slc37a4 PE=1 SV=1
4	AFDB:F1R0A9	0.992	0.992	6.362E-49	429	0.739	0.739	F1R0A9.pdb.gz
5	AFDB:P09836	0.697	0.684	3.258E-20	439	0.284	0.278	P09836.pdb.gz	UHPC_ECOLI Membrane sensor protein UhpC OS=Escherichia coli (strain K12) OX=83333 GN=uhpC PE=1 SV=3
6	AFDB:P08194	0.856	0.814	9.622E-19	452	0.249	0.237	P08194.pdb.gz	GLPT_ECOLI Glycerol-3-phosphate transporter OS=Escherichia coli (strain K12) OX=83333 GN=glpT PE=1 SV=1
7	AFDB:O82390	0.820	0.695	7.088E-16	512	0.163	0.137	O82390.pdb.gz	ANTR1_ARATH Sodium-dependent phosphate transport protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ANTR1 PE=1 SV=1
8	PDB:1pw4A	0.802	0.794	9.106E-16	434	0.259	0.256	1pw4A.pdb.gz
9	AFDB:P0AA76	0.825	0.824	9.137E-16	430	0.168	0.167	P0AA76.pdb.gz	DGOT_ECOLI D-galactonate transporter OS=Escherichia coli (strain K12) OX=83333 GN=dgoT PE=1 SV=1
10	AFDB:P0AGC0	0.811	0.756	1.455E-15	463	0.221	0.205	P0AGC0.pdb.gz	UHPT_ECOLI Hexose-6-phosphate:phosphate antiporter OS=Escherichia coli (strain K12) OX=83333 GN=uhpT PE=1 SV=1
11	AFDB:Q46916	0.836	0.799	2.130E-15	450	0.212	0.202	Q46916.pdb.gz	GUDP_ECOLI Probable galactarate/D-glucarate transporter GudP OS=Escherichia coli (strain K12) OX=83333 GN=gudP PE=1 SV=1
12	PDB:6kkkA	0.731	0.815	8.354E-11	381	0.156	0.176	6kkkA.pdb.gz
13	PDB:7bp3A	0.690	0.746	5.286E-9	394	0.128	0.140	7bp3A.pdb.gz
14	PDB:6oopA	0.666	0.721	5.752E-9	392	0.142	0.156	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.
15	PDB:7yr5A	0.753	0.833	6.531E-9	385	0.131	0.145	7yr5A.pdb.gz
16	PDB:7aaqA	0.572	0.516	3.403E-8	487	0.198	0.175	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
17	PDB:7dl9A	0.675	0.711	3.403E-8	405	0.135	0.143	7dl9A.pdb.gz
18	PDB:6thaA	0.690	0.665	4.386E-8	448	0.147	0.141	6thaA.pdb.gz
19	PDB:4ja4A	0.675	0.658	4.774E-8	442	0.163	0.158	4ja4A.pdb.gz
20	PDB:7wsmA	0.672	0.629	5.195E-8	464	0.189	0.175	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTY3	0.0	681	455	0.823	0.776	A0A0G2JTY3_RAT Solute carrier family 37 member 4 OS=Rattus norvegicus OX=10116 GN=Slc37a4 PE=1 SV=2
2	A0A1L1SUI3	0.0	778	450	0.930	0.887	A0A1L1SUI3_MOUSE Solute carrier family 37 (glucose-6-phosphate transporter), member 4 OS=Mus musculus OX=10090 GN=Slc37a4 PE=1 SV=1
3	F7EWB7	0.0	693	434	0.823	0.813	F7EWB7_RAT Solute carrier family 37 member 4 OS=Rattus norvegicus OX=10116 GN=Slc37a4 PE=1 SV=1
4	O43826	0.0	864	429	1.000	1.000	G6PT1_HUMAN Glucose-6-phosphate exchanger SLC37A4 OS=Homo sapiens OX=9606 GN=SLC37A4 PE=1 SV=1
5	Q6IRK4	0.0	791	429	0.930	0.930	Q6IRK4_RAT Solute carrier family 37 (Glucose-6-phosphate transporter), member 4 OS=Rattus norvegicus OX=10116 GN=Slc37a4 PE=2 SV=1
6	Q6NY67	0.0	662	429	0.739	0.739	Q6NY67_DANRE Glucose-6-phosphate translocase OS=Danio rerio OX=7955 GN=slc37a4 PE=1 SV=1
7	Q9D1F9	0.0	791	429	0.930	0.930	Q9D1F9_MOUSE Solute carrier family 37 (Glucose-6-phosphate transporter), member 4 OS=Mus musculus OX=10090 GN=Slc37a4 PE=1 SV=1
8	Q9Z295	0.0	794	429	0.935	0.935	Q9Z295_MOUSE Putative glycogen storage disease type 1b protein OS=Mus musculus OX=10090 GN=Slc37a4 PE=2 SV=1
9	P09836	5.10e-63	211	439	0.305	0.298	UHPC_ECOLI Membrane sensor protein UhpC OS=Escherichia coli (strain K12) OX=83333 GN=uhpC PE=1 SV=3
10	A0A1L1SUV7	1.22e-50	168	102	0.217	0.912	A0A1L1SUV7_MOUSE Solute carrier family 37 (glucose-6-phosphate transporter), member 4 (Fragment) OS=Mus musculus OX=10090 GN=Slc37a4 PE=1 SV=1
11	P08194	5.72e-40	150	452	0.263	0.250	GLPT_ECOLI Glycerol-3-phosphate transporter OS=Escherichia coli (strain K12) OX=83333 GN=glpT PE=1 SV=1
12	A0A1L1SV42	8.99e-27	105	96	0.121	0.542	A0A1L1SV42_MOUSE Solute carrier family 37 (glucose-6-phosphate transporter), member 4 (Fragment) OS=Mus musculus OX=10090 GN=Slc37a4 PE=1 SV=1
13	Q46916	4.04e-19	91.3	450	0.207	0.198	GUDP_ECOLI Probable galactarate/D-glucarate transporter GudP OS=Escherichia coli (strain K12) OX=83333 GN=gudP PE=1 SV=1
14	Q8NCC5	8.82e-12	68.9	494	0.179	0.156	SPX3_HUMAN Sugar phosphate exchanger 3 OS=Homo sapiens OX=9606 GN=SLC37A3 PE=1 SV=2
15	Q7SY29	1.08e-10	65.9	494	0.135	0.117	G6PT3_DANRE Glucose-6-phosphate exchanger SLC37A2 OS=Danio rerio OX=7955 GN=slc37a2 PE=2 SV=1
16	P0AA80	2.57e-10	64.3	444	0.200	0.194	GARP_ECOLI Probable galactarate/D-glucarate transporter GarP OS=Escherichia coli (strain K12) OX=83333 GN=garP PE=1 SV=1
17	P0AGC0	1.78e-09	61.6	463	0.238	0.220	UHPT_ECOLI Hexose-6-phosphate:phosphate antiporter OS=Escherichia coli (strain K12) OX=83333 GN=uhpT PE=1 SV=1
18	Q9SA71	2.90e-09	61.2	510	0.189	0.159	GLPT3_ARATH Putative glycerol-3-phosphate transporter 3 OS=Arabidopsis thaliana OX=3702 GN=At1g30560 PE=3 SV=1
19	P57057	1.77e-08	58.9	533	0.228	0.184	G6PT2_HUMAN Glucose-6-phosphate exchanger SLC37A1 OS=Homo sapiens OX=9606 GN=SLC37A1 PE=2 SV=2
20	Q8TED4	6.19e-08	57.0	501	0.186	0.160	G6PT3_HUMAN Glucose-6-phosphate exchanger SLC37A2 OS=Homo sapiens OX=9606 GN=SLC37A2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	1e-46	171.1	Major Facilitator Superfamily
2	PF00083 Sugar_tr	0.0069	26.9	Sugar (and other) transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000010595

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000009856	0.811	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol- pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER)
2	9555.ENSPANP00000007651	0.810	trans-2,3-enoyl-CoA reductase
3	9555.ENSPANP00000020738	0.707	Glucose-6-phosphatase, catalytic subunit
4	9555.ENSPANP00000000290	0.705	Belongs to the TRAPP small subunits family.
5	9555.ENSPANP00000000627	0.700	Coiled-coil domain containing 84
6	9555.ENSPANP00000005354	0.677	Solute carrier family 35 (UDP-GlcA/UDP-GalNAc transporter), member D1
7	9555.ENSPANP00000010866	0.660	Ring finger protein 26
8	9555.ENSPANP00000013809	0.656	Solute carrier family 17 (organic anion transporter), member 3
9	9555.ENSPANP00000020770	0.642	Glucose-6-phosphatase
10	9555.ENSPANP00000004101	0.593	Sodium-phosphate symporter which plays a fundamental housekeeping role in phosphate transport.
11	9555.ENSPANP00000015389	0.589	Sodium-phosphate symporter which plays a fundamental housekeeping role in phosphate transport.
12	9555.ENSPANP00000001288	0.585	Coiled-coil domain containing 153
13	9555.ENSPANP00000009791	0.560	Electron-transfer-flavoprotein, beta polypeptide
14	9555.ENSPANP00000014963	0.548	UDP-N-acetylglucosamine pyrophosphorylase 1
15	9555.ENSPANP00000017474	0.548	UDP-N-acetylglucosamine pyrophosphorylase 1 like 1
16	9555.ENSPANP00000019912	0.538	TAO kinase 1
17	9555.ENSPANP00000014299	0.537	Electron-transfer-flavoprotein, alpha polypeptide
18	9555.ENSPANP00000010965	0.534	Accepts electrons from ETF and reduces ubiquinone.
19	9555.ENSPANP00000008247	0.525	Melanoma cell adhesion molecule
20	9555.ENSPANP00000006928	0.523	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901505	1.000	carbohydrate derivative transmembrane transporter activity
GO:0015605	1.000	organophosphate ester transmembrane transporter activity
GO:0015114	1.000	phosphate ion transmembrane transporter activity
GO:0005452	0.999	solute:inorganic anion antiporter activity
GO:0015152	0.943	glucose-6-phosphate transmembrane transporter activity
GO:0005488	0.911	binding
GO:0005515	0.900	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901264	0.997	carbohydrate derivative transport
GO:0015748	0.997	organophosphate ester transport
GO:0071704	0.996	organic substance metabolic process
GO:0006006	0.987	glucose metabolic process
GO:0009987	0.983	cellular process
GO:0016051	0.979	carbohydrate biosynthetic process
GO:0006094	0.973	gluconeogenesis
GO:0033500	0.908	carbohydrate homeostasis
GO:0044237	0.856	cellular metabolic process
GO:0065007	0.538	biological regulation
GO:0050896	0.514	response to stimulus
GO:0050789	0.408	regulation of biological process
GO:0006091	0.365	generation of precursor metabolites and energy
GO:0032501	0.364	multicellular organismal process
GO:0042221	0.351	response to chemical
GO:0042593	0.350	glucose homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0042175	0.999	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.991	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:32823	1.000	phosphate(in) = phosphate(out)

[back to server]