StarFunc result for job id O43837

User Input

>input (385 residues)
MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVG
PELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPME
YKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESAR
GVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELY
PKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEY
AVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRT
RDMGGYSTTTDFIKSVIGHLQTKGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A087WZN1	0.932	0.927	1.538E-74	387	1.000	0.995	A0A087WZN1.pdb.gz	A0A087WZN1_HUMAN Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=1
2	AFDB:Q9VD58	0.869	0.904	2.212E-52	370	0.548	0.570	Q9VD58.pdb.gz	Q9VD58_DROME GH26270p OS=Drosophila melanogaster OX=7227 GN=Idh3b PE=1 SV=1
3	AFDB:P41565	0.853	0.836	5.215E-49	393	0.494	0.483	P41565.pdb.gz	IDHG1_RAT Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Idh3g PE=1 SV=2
4	AFDB:Q8BPC6	0.854	0.831	3.096E-47	396	0.439	0.427	Q8BPC6.pdb.gz	IDHG2_MOUSE Probable isocitrate dehydrogenase [NAD] gamma 2, mitochondrial OS=Mus musculus OX=10090 PE=2 SV=1
5	AFDB:O13696	0.850	0.918	4.623E-46	356	0.423	0.458	O13696.pdb.gz	IDH1_SCHPO Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=idh1 PE=1 SV=1
6	AFDB:P28834	0.847	0.904	5.177E-45	360	0.421	0.450	P28834.pdb.gz	IDH1_YEAST Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IDH1 PE=1 SV=2
7	AFDB:Q8LG77	0.842	0.867	1.300E-44	374	0.452	0.465	Q8LG77.pdb.gz	IDH6_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH6 PE=1 SV=2
8	AFDB:Q54B68	0.838	0.895	1.733E-44	360	0.418	0.447	Q54B68.pdb.gz	IDHB_DICDI Isocitrate dehydrogenase [NAD] regulatory subunit B, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=idhB PE=3 SV=1
9	AFDB:Q8LFC0	0.835	0.875	2.592E-44	367	0.449	0.471	Q8LFC0.pdb.gz	IDH1_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH1 PE=1 SV=2
10	AFDB:P93032	0.812	0.851	4.607E-44	367	0.449	0.471	P93032.pdb.gz	IDH2_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH2 PE=1 SV=2
11	PDB:7ce3B	0.840	0.935	9.417E-44	345	0.475	0.530	7ce3B.pdb.gz
12	PDB:3blvC	0.830	0.927	9.939E-42	344	0.413	0.462	3blvC.pdb.gz	Allosteric Motions in Structures of Yeast NAD+-specific Isocitrate Dehydrogenase.
13	PDB:6kdfE	0.793	0.897	4.411E-38	338	0.392	0.447	6kdfE.pdb.gz
14	PDB:4yb4A	0.800	0.922	4.913E-34	333	0.306	0.354	4yb4A.pdb.gz	Structure of homoisocitrate dehydrogenase from Thermus thermophilus in complex with homoisocitrate, magnesium(II) and NADH
15	PDB:3blvH	0.771	0.848	1.845E-33	348	0.332	0.368	3blvH.pdb.gz	Allosteric Motions in Structures of Yeast NAD+-specific Isocitrate Dehydrogenase.
16	PDB:3ty3A	0.773	0.828	2.596E-31	358	0.278	0.299	3ty3A.pdb.gz	Crystal structure of homoisocitrate dehydrogenase from Schizosaccharomyces pombe.
17	PDB:4aj3A	0.796	0.739	3.074E-29	416	0.265	0.245	4aj3A.pdb.gz	Induced Fit and the Catalytic Mechanism of Isocitrate Dehydrogenase.
18	PDB:1hqsA	0.801	0.732	6.492E-29	423	0.273	0.248	1hqsA.pdb.gz
19	PDB:2g4oD	0.774	0.879	1.539E-28	337	0.234	0.267	2g4oD.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
20	PDB:2y42D	0.722	0.777	3.442E-28	355	0.265	0.287	2y42D.pdb.gz	Atomic Level Description of the Domain Closure in a Dimeric Enzyme: Thermus Thermophilus 3-Isopropylmalate Dehydrogenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WZN1	0.0	801	387	1.000	0.995	A0A087WZN1_HUMAN Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=1
2	A0A087X2E5	0.0	741	376	0.927	0.949	A0A087X2E5_HUMAN Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=1
3	A0A668KL51	0.0	729	380	0.909	0.921	A0A668KL51_MOUSE Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Mus musculus OX=10090 GN=Idh3b PE=1 SV=1
4	O43837	0.0	800	385	1.000	1.000	IDH3B_HUMAN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=2
5	Q68FX0	0.0	712	385	0.940	0.940	IDH3B_RAT Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Idh3B PE=2 SV=1
6	Q91VA7	0.0	749	384	0.935	0.938	Q91VA7_MOUSE Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Mus musculus OX=10090 GN=Idh3b PE=1 SV=1
7	Q9VD58	1.24e-148	427	370	0.566	0.589	Q9VD58_DROME GH26270p OS=Drosophila melanogaster OX=7227 GN=Idh3b PE=1 SV=1
8	P51553	1.54e-125	369	393	0.475	0.466	IDH3G_HUMAN Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3G PE=1 SV=1
9	P41565	3.48e-125	368	393	0.483	0.473	IDHG1_RAT Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Idh3g PE=1 SV=2
10	P70404	4.47e-125	368	393	0.483	0.473	IDHG1_MOUSE Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Mus musculus OX=10090 GN=Idh3g PE=1 SV=1
11	Q8BPC6	2.26e-119	353	396	0.439	0.427	IDHG2_MOUSE Probable isocitrate dehydrogenase [NAD] gamma 2, mitochondrial OS=Mus musculus OX=10090 PE=2 SV=1
12	G5E9Q7	8.95e-118	347	322	0.442	0.528	G5E9Q7_HUMAN Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3G PE=1 SV=1
13	E7EQB8	3.56e-117	345	340	0.439	0.497	E7EQB8_HUMAN Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3G PE=1 SV=1
14	O13696	1.73e-116	344	356	0.434	0.469	IDH1_SCHPO Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=idh1 PE=1 SV=1
15	P93032	4.67e-113	336	367	0.442	0.463	IDH2_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH2 PE=1 SV=2
16	Q945K7	2.47e-112	335	374	0.426	0.439	IDH5_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH5 PE=1 SV=1
17	Q8LFC0	4.34e-112	333	367	0.439	0.460	IDH1_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH1 PE=1 SV=2
18	P28834	1.31e-111	332	360	0.426	0.456	IDH1_YEAST Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IDH1 PE=1 SV=2
19	O81796	1.85e-110	330	368	0.439	0.459	IDH3_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH3 PE=1 SV=1
20	Q8LG77	2.27e-109	327	374	0.429	0.441	IDH6_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07726 AAA_3	58	15.0	ATPase family associated with various cellular activities (AAA)
2	PF00180 Iso_dh	2e-71	252.6	Isocitrate/isopropylmalate dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370223

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299518	0.999	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
2	9606.ENSP00000216254	0.996	Aconitate hydratase, mitochondrial
3	9606.ENSP00000331897	0.996	Isocitrate dehydrogenase [NADP], mitochondrial
4	9606.ENSP00000217901	0.995	Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
5	9606.ENSP00000390265	0.995	Isocitrate dehydrogenase 1, cytosolic
6	9606.ENSP00000222673	0.982	2-oxoglutarate dehydrogenase, mitochondrial
7	9606.ENSP00000377446	0.976	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
8	9606.ENSP00000363216	0.972	2-oxoglutarate dehydrogenase-like, mitochondrial
9	9606.ENSP00000309477	0.966	Cytoplasmic aconitate hydratase
10	9606.ENSP00000203407	0.952	Cytochrome b-c1 complex subunit 1, mitochondrial
11	9606.ENSP00000327070	0.950	Malate dehydrogenase, mitochondrial
12	9606.ENSP00000364649	0.948	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
13	9606.ENSP00000328551	0.946	Ras-related protein Rab-28
14	9606.ENSP00000342056	0.939	Citrate synthase, mitochondrial
15	9606.ENSP00000356972	0.906	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
16	9606.ENSP00000327589	0.895	Glutamate dehydrogenase 2, mitochondrial
17	9606.ENSP00000245206	0.893	Aspartate aminotransferase, mitochondrial
18	9606.ENSP00000317159	0.891	Cytochrome c1, heme protein, mitochondrial
19	9606.ENSP00000277865	0.890	Glutamate dehydrogenase 1, mitochondrial
20	9606.ENSP00000367923	0.885	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004449	1.000	isocitrate dehydrogenase (NAD+) activity
GO:0005515	0.995	protein binding
GO:0043167	0.501	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0072350	0.996	tricarboxylic acid metabolic process
GO:0006066	0.995	alcohol metabolic process
GO:0006099	0.986	tricarboxylic acid cycle
GO:1902652	0.959	secondary alcohol metabolic process
GO:0006807	0.473	nitrogen compound metabolic process
GO:1901564	0.370	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:1990204	0.986	oxidoreductase complex
GO:0098798	0.966	mitochondrial protein-containing complex
GO:0005759	0.959	mitochondrial matrix
GO:0030062	0.925	mitochondrial tricarboxylic acid cycle enzyme complex
GO:0005634	0.877	nucleus
GO:0016020	0.634	membrane
GO:0031981	0.354	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23632	1.000	D-threo-isocitrate + NAD(+) = 2-oxoglutarate + CO2 + NADH
EC:1.1.1.41	1.000	isocitrate dehydrogenase (NAD(+)).

[back to server]