StarFunc result for job id O43847

User Input

>input (1151 residues)
MLRRVTVAAVCATRRKLCEAGRELAALWGIETRGRCEDSAAARPFPILAMPGRNKAKSTC
SCPDLQPNGQDLGENSRVARLGADESEEEGRRGSLSNAGDPEIVKSPSDPKQYRYIKLQN
GLQALLISDLSNMEGKTGNTTDDEEEEEVEEEEEDDDEDSGAEIEDDDEEGFDDEDEFDD
EHDDDLDTEDNELEELEERAEARKKTTEKQSAAALCVGVGSFADPDDLPGLAHFLEHMVF
MGSLKYPDENGFDAFLKKHGGSDNASTDCERTVFQFDVQRKYFKEALDRWAQFFIHPLMI
RDAIDREVEAVDSEYQLARPSDANRKEMLFGSLARPGHPMGKFFWGNAETLKHEPRKNNI
DTHARLREFWMRYYSSHYMTLVVQSKETLDTLEKWVTEIFSQIPNNGLPRPNFGHLTDPF
DTPAFNKLYRVVPIRKIHALTITWALPPQQQHYRVKPLHYISWLVGHEGKGSILSFLRKK
CWALALFGGNGETGFEQNSTYSVFSISITLTDEGYEHFYEVAYTVFQYLKMLQKLGPEKR
IFEEIRKIEDNEFHYQEQTDPVEYVENMCENMQLYPLQDILTGDQLLFEYKPEVIGEALN
QLVPQKANLVLLSGANEGKCDLKEKWFGTQYSIEDIENSWAELWNSNFELNPDLHLPAEN
KYIATDFTLKAFDCPETEYPVKIVNTPQGCLWYKKDNKFKIPKAYIRFHLISPLIQKSAA
NVVLFDIFVNILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHKLPLLFQLIIDY
LAEFNSTPAVFTMITEQLKKTYFNILIKPETLAKDVRLLILEYARWSMIDKYQALMDGLS
LESLLSFVKEFKSQLFVEGLVQGNVTSTESMDFLKYVVDKLNFKPLEQEMPVQFQVVELP
SGHHLCKVKALNKGDANSEVTVYYQSGTRSLREYTLMELLVMHMEEPCFDFLRTKQTLGY
HVYPTCRNTSGILGFSVTVGTQATKYNSEVVDKKIEEFLSSFEEKIENLTEEAFNTQVTA
LIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFSKSDLVNWFKAHRGPGS
KMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFTTT
LNLLPYHKIVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P47245	0.881	0.874	0.000	1161	0.922	0.914	P47245.pdb.gz	NRDC_RAT Nardilysin OS=Rattus norvegicus OX=10116 GN=Nrdc PE=1 SV=1
2	AFDB:Q9VYT3	0.795	0.798	2.251E-91	1147	0.316	0.317	Q9VYT3.pdb.gz	Q9VYT3_DROME FI23714p1 OS=Drosophila melanogaster OX=7227 GN=Nrd1 PE=1 SV=2
3	AFDB:F4HNU6	0.809	0.907	2.744E-91	1024	0.307	0.345	F4HNU6.pdb.gz	NRDC_ARATH Nardilysin-like OS=Arabidopsis thaliana OX=3702 GN=At1g06900 PE=2 SV=1
4	AFDB:P14735	0.788	0.887	3.417E-90	1019	0.298	0.337	P14735.pdb.gz	IDE_HUMAN Insulin-degrading enzyme OS=Homo sapiens OX=9606 GN=IDE PE=1 SV=4
5	AFDB:A0A0R4IL71	0.787	0.905	2.237E-89	998	0.287	0.331	A0A0R4IL71.pdb.gz	A0A0R4IL71_DANRE Insulin-degrading enzyme OS=Danio rerio OX=7955 GN=CH211-129M12.3 PE=1 SV=1
6	AFDB:P22817	0.790	0.916	1.169E-87	990	0.283	0.329	P22817.pdb.gz	IDE_DROME Insulin-degrading enzyme OS=Drosophila melanogaster OX=7227 GN=Ide PE=1 SV=4
7	PDB:2g49A	0.783	0.927	2.500E-87	970	0.289	0.343	2g49A.pdb.gz	Structures of human insulin-degrading enzyme reveal a new substrate recognition mechanism.
8	AFDB:O22941	0.779	0.921	3.912E-86	970	0.295	0.349	O22941.pdb.gz	IDE1_ARATH Insulin-degrading enzyme-like 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PXM16 PE=2 SV=1
9	PDB:4iofA	0.766	0.943	2.083E-84	932	0.290	0.358	4iofA.pdb.gz	Conformational states and recognition of amyloidogenic peptides of human insulin-degrading enzyme.
10	AFDB:Q06010	0.792	0.885	9.884E-82	1027	0.247	0.277	Q06010.pdb.gz	STE23_YEAST A-factor-processing enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STE23 PE=1 SV=2
11	AFDB:O14077	0.782	0.926	1.576E-80	969	0.239	0.284	O14077.pdb.gz	MU138_SCHPO Putative zinc protease mug138 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug138 PE=1 SV=1
12	AFDB:A0A1D8PQ06	0.769	0.821	4.007E-78	1077	0.255	0.273	A0A1D8PQ06.pdb.gz	A0A1D8PQ06_CANAL Metalloendopeptidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STE23 PE=4 SV=1
13	PDB:4iofB	0.689	0.913	5.822E-73	861	0.265	0.354	4iofB.pdb.gz	Conformational states and recognition of amyloidogenic peptides of human insulin-degrading enzyme.
14	PDB:1q2lA	0.475	0.568	5.252E-64	937	0.205	0.252	1q2lA.pdb.gz	Crystal Structure of pitrilysin, the prototype of insulin-degrading enzymes
15	PDB:6ofsA	0.321	0.399	6.071E-32	905	0.104	0.133	6ofsA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.
16	PDB:6xovA	0.525	0.614	3.045E-25	966	0.116	0.138	6xovA.pdb.gz	Structural basis for the mechanisms of human presequence protease conformational switch and substrate recognition.
17	PDB:2fgeA	0.526	0.608	3.532E-25	979	0.129	0.151	2fgeA.pdb.gz	The closed structure of presequence protease PreP forms a unique 10 000 A(3) chamber for proteolysis
18	PDB:4rpuA	0.538	0.618	6.085E-25	988	0.118	0.138	4rpuA.pdb.gz	Crystal Structure of Human Presequence Protease in Complex with Inhibitor MitoBloCK-60
19	PDB:3s5mA	0.516	0.540	1.794E-22	1094	0.108	0.113	3s5mA.pdb.gz	Crystal structures of falcilysin, a M16 metalloprotease from the malaria parasite Plasmodium falciparum
20	PDB:7diaA	0.508	0.540	3.248E-22	1072	0.110	0.118	7diaA.pdb.gz	Protease in complex with inhibitor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43847	0.0	2396	1151	1.000	1.000	NRDC_HUMAN Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3
2	P47245	0.0	2103	1161	0.919	0.911	NRDC_RAT Nardilysin OS=Rattus norvegicus OX=10116 GN=Nrdc PE=1 SV=1
3	Q8BHG1	0.0	2111	1161	0.926	0.918	NRDC_MOUSE Nardilysin OS=Mus musculus OX=10090 GN=Nrdc PE=1 SV=1
4	Q9VYT3	0.0	611	1147	0.285	0.286	Q9VYT3_DROME FI23714p1 OS=Drosophila melanogaster OX=7227 GN=Nrd1 PE=1 SV=2
5	F4HNU6	1.33e-178	553	1024	0.272	0.306	NRDC_ARATH Nardilysin-like OS=Arabidopsis thaliana OX=3702 GN=At1g06900 PE=2 SV=1
6	P35559	3.14e-175	544	1019	0.271	0.306	IDE_RAT Insulin-degrading enzyme OS=Rattus norvegicus OX=10116 GN=Ide PE=1 SV=1
7	P14735	9.27e-174	540	1019	0.269	0.304	IDE_HUMAN Insulin-degrading enzyme OS=Homo sapiens OX=9606 GN=IDE PE=1 SV=4
8	Q9JHR7	1.63e-172	537	1019	0.267	0.301	IDE_MOUSE Insulin-degrading enzyme OS=Mus musculus OX=10090 GN=Ide PE=1 SV=1
9	A4QP10	2.62e-168	525	978	0.272	0.320	A4QP10_DANRE Insulin-degrading enzyme OS=Danio rerio OX=7955 GN=ide PE=1 SV=1
10	A0A0R4IL71	3.32e-168	525	998	0.272	0.314	A0A0R4IL71_DANRE Insulin-degrading enzyme OS=Danio rerio OX=7955 GN=CH211-129M12.3 PE=1 SV=1
11	O22941	3.85e-167	521	970	0.284	0.337	IDE1_ARATH Insulin-degrading enzyme-like 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PXM16 PE=2 SV=1
12	P22817	7.77e-157	495	990	0.274	0.318	IDE_DROME Insulin-degrading enzyme OS=Drosophila melanogaster OX=7227 GN=Ide PE=1 SV=4
13	O14077	1.44e-121	400	969	0.233	0.277	MU138_SCHPO Putative zinc protease mug138 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug138 PE=1 SV=1
14	Q06010	1.66e-121	402	1027	0.237	0.266	STE23_YEAST A-factor-processing enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STE23 PE=1 SV=2
15	Q7MIS6	1.02e-115	383	925	0.235	0.293	Q7MIS6_VIBVY Protease 3 OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=VV2439 PE=1 SV=1
16	A0A1D8PQ06	4.75e-115	385	1077	0.247	0.264	A0A1D8PQ06_CANAL Metalloendopeptidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STE23 PE=4 SV=1
17	P05458	2.64e-70	256	962	0.200	0.239	PTRA_ECOLI Protease 3 OS=Escherichia coli (strain K12) OX=83333 GN=ptrA PE=1 SV=1
18	Q57YQ9	1.33e-53	206	1064	0.186	0.201	Q57YQ9_TRYB2 Peptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.800 PE=3 SV=1
19	P40851	9.48e-22	104	1208	0.056	0.054	AXL1_YEAST Putative protease AXL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AXL1 PE=1 SV=2
20	Q9KA85	9.79e-11	67.8	413	0.046	0.128	Q9KA85_HALH5 Processing protease OS=Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=BH2405 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02724 CDC45	3.2e+02	11.0	CDC45-like protein
2	PF19610 DUF6115	1.8e+02	13.6	Family of unknown function (DUF6115)
3	PF04147 Nop14	2.7e+02	11.2	Nop14-like family
4	PF00675 Peptidase_M16	1.7e-37	140.2	Insulinase (Peptidase family M16)
5	PF05193 Peptidase_M16_C	8.5e-38	141.7	Peptidase M16 inactive domain
6	PF16187 Peptidase_M16_M	8.3e-89	309.2	Middle or third domain of peptidase_M16
7	PF05285 SDA1	2e+02	12.8	SDA1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000016747

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000006039	0.779	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
2	60711.ENSCSAP00000004291	0.728	Islet amyloid polypeptide
3	60711.ENSCSAP00000013576	0.722	ArfGAP with dual PH domains 1
4	60711.ENSCSAP00000011719	0.687	Glucagon
5	60711.ENSCSAP00000011024	0.663	Senataxin
6	60711.ENSCSAP00000009083	0.650	Heparin-binding EGF-like growth factor
7	60711.ENSCSAP00000005143	0.641	Programmed cell death 1 ligand 2
8	60711.ENSCSAP00000005066	0.640	annotation not available
9	60711.ENSCSAP00000016049	0.640	annotation not available
10	60711.ENSCSAP00000016731	0.637	Sterol carrier protein 2
11	60711.ENSCSAP00000006739	0.612	Mitochondrial ribosomal protein L3
12	60711.ENSCSAP00000014387	0.612	Nitric oxide associated 1
13	60711.ENSCSAP00000010400	0.594	Leucyl/cystinyl aminopeptidase
14	60711.ENSCSAP00000005302	0.589	Amyloid beta (A4) precursor protein
15	60711.ENSCSAP00000015845	0.589	Amyloid beta (A4) precursor-like protein 2
16	60711.ENSCSAP00000012060	0.580	Epoxide hydrolase 2, cytoplasmic
17	60711.ENSCSAP00000015768	0.579	Acts as NAD-dependent protein lipoamidase, ADP-ribosyl transferase and deacetylase. Catalyzes more efficiently removal of lipoyl- and biotinyl- than acetyl-lysine modifications. Inhibits the pyruvate dehydrogenase complex (PDH) activity via the enzymatic hydrolysis of the lipoamide cofactor from the E2 component, DLAT, in a phosphorylation-independent manner. Catalyzes the transfer of ADP- ribosyl groups onto target proteins, including mitochondrial GLUD1, inhibiting GLUD1 enzyme activity. Acts as a negative regulator of mitochondrial glutamine metabolism by mediating mono ADP-ribosyla [...]
18	60711.ENSCSAP00000001735	0.565	ATP-dependent serine protease that mediates the selective degradation of misfolded and unassembled polypeptides in the peroxisomal matrix. Necessary for type 2 peroxisome targeting signal (PTS2)-containing protein processing and facilitates peroxisome matrix protein import. May indirectly regulate peroxisomal fatty acid beta- oxidation through degradation of the self-processed forms of TYSND1.
19	60711.ENSCSAP00000006936	0.561	Hepatitis A virus cellular receptor 2
20	60711.ENSCSAP00000004143	0.555	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0008233	0.995	peptidase activity
GO:1901363	0.825	heterocyclic compound binding
GO:0097159	0.825	organic cyclic compound binding
GO:0004175	0.780	endopeptidase activity
GO:0008237	0.697	metallopeptidase activity
GO:0042562	0.552	hormone binding
GO:0043167	0.441	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009896	0.995	positive regulation of catabolic process
GO:0030162	0.995	regulation of proteolysis
GO:0050794	0.984	regulation of cellular process
GO:0045862	0.976	positive regulation of proteolysis
GO:0048522	0.953	positive regulation of cellular process
GO:0042176	0.942	regulation of protein catabolic process
GO:0031331	0.935	positive regulation of cellular catabolic process
GO:0045732	0.856	positive regulation of protein catabolic process
GO:0050790	0.774	regulation of catalytic activity
GO:0009987	0.654	cellular process
GO:0071704	0.442	organic substance metabolic process
GO:0044238	0.404	primary metabolic process
GO:0006807	0.396	nitrogen compound metabolic process
GO:0043170	0.388	macromolecule metabolic process
GO:0048519	0.363	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0005829	0.936	cytosol
GO:0009986	0.492	cell surface
GO:0070013	0.359	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.995	Acting on peptide bonds (peptidases).

[back to server]