StarFunc result for job id O43861

User Input

>input (1147 residues)
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEE
GFENEESDYHTLPRARIMQRKRGLEWFVCDGWKFLCTSCCGWLINICRRKKELKARTVWL
GCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPALKIGYLY
TYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLYSKLTVRGKVQVKSSDIQVGDLIIV
EKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQQLPALGDLFSISAYV
YAQKPQMDIHSFEGTFTREDSDPPIHESLSIENTLWASTIVASGTVIGVVIYTGKETRSV
MNTSNPKNKVGLLDLELNRLTKALFLALVALSIVMVTLQGFVGPWYRNLFRFLLLFSYII
PISLRVNLDMGKAVYGWMMMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMIF
KRLHLGTVSYGADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSR
IHEAVKAIVLCHNVTPVYESRAGVTEETEFAEADQDFSDENRTYQASSPDEVALVQWTES
VGLTLVSRDLTSMQLKTPSGQVLSFCILQLFPFTSESKRMGVIVRDESTAEITFYMKGAD
VAMSPIVQYNDWLEEECGNMAREGLRTLVVAKKALTEEQYQDFESRYTQAKLSMHDRSLK
VAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSS
HLVSRTQDIHIFRQVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEHEFVELACQ
CPAVVCCRCSPTQKARIVTLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQAS
LAADFSITQFRHIGRLLMVHGRNSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPL
YQGFLMVGYATIYTMFPVFSLVLDQDVKPEMAMLYPELYKDLTKGRSLSFKTFLIWVLIS
IYQGGILMYGALVLFESEFVHVVAISFTALILTELLMVALTVRTWHWLMVVAEFLSLGCY
VSSLAFLNEYFGIGRVSFGAFLDVAFITTVTFLWKVSAITVVSCLPLYVLKYLRRKLSPP
SYCKLAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5EBH1	0.848	0.905	0.000	1074	0.541	0.578	G5EBH1.pdb.gz	TAT5_CAEEL Probable phospholipid-transporting ATPase tat-5 OS=Caenorhabditis elegans OX=6239 GN=tat-5 PE=1 SV=1
2	AFDB:O43861	1.000	1.000	0.000	1147	1.000	1.000	O43861.pdb.gz	ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens OX=9606 GN=ATP9B PE=2 SV=4
3	AFDB:O75110	0.861	0.941	0.000	1047	0.693	0.759	O75110.pdb.gz	ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens OX=9606 GN=ATP9A PE=1 SV=3
4	AFDB:P40527	0.835	0.832	0.000	1151	0.455	0.454	P40527.pdb.gz	ATC7_YEAST Phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NEO1 PE=1 SV=1
5	AFDB:Q10309	0.806	0.894	1.147E-99	1033	0.416	0.462	Q10309.pdb.gz	ATC7_SCHPO Phospholipid-transporting ATPase neo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=neo1 PE=3 SV=1
6	AFDB:Q581T0	0.820	0.870	1.520E-96	1080	0.377	0.400	Q581T0.pdb.gz	Q581T0_TRYB2 Phospholipid-transporting ATPase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.780 PE=3 SV=1
7	PDB:7rd6A	0.745	0.911	1.726E-86	929	0.432	0.533	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
8	AFDB:Q9Y2G3	0.818	0.798	2.593E-81	1177	0.274	0.267	Q9Y2G3.pdb.gz	AT11B_HUMAN Phospholipid-transporting ATPase IF OS=Homo sapiens OX=9606 GN=ATP11B PE=1 SV=2
9	AFDB:F4K8T6	0.806	0.811	2.113E-79	1139	0.277	0.279	F4K8T6.pdb.gz	F4K8T6_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=ALA2 PE=1 SV=1
10	AFDB:Q8NB49	0.796	0.806	9.295E-79	1132	0.269	0.272	Q8NB49.pdb.gz	AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens OX=9606 GN=ATP11C PE=1 SV=3
11	AFDB:Q9LNQ4	0.802	0.758	3.914E-78	1216	0.263	0.248	Q9LNQ4.pdb.gz	ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana OX=3702 GN=ALA4 PE=3 SV=2
12	PDB:6rohA	0.789	0.812	1.380E-67	1112	0.262	0.270	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
13	PDB:7kycA	0.797	0.777	3.298E-67	1178	0.254	0.247	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
14	PDB:7py4A	0.744	0.766	1.828E-64	1112	0.252	0.260	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
15	PDB:7kyaA	0.794	0.776	1.994E-64	1174	0.250	0.244	7kyaA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
16	PDB:7vghB	0.768	0.746	7.698E-64	1183	0.258	0.250	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
17	PDB:7bspA	0.641	0.704	9.006E-60	1028	0.258	0.288	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
18	PDB:6k7lA	0.735	0.844	4.323E-59	992	0.255	0.295	6k7lA.pdb.gz	Cryo-EM structures capture the transport cycle of the P4-ATPase flippase.
19	PDB:6lknA	0.719	0.771	2.380E-57	1064	0.255	0.274	6lknA.pdb.gz	Crystal structure of a human plasma membrane phospholipid flippase.
20	PDB:7bssA	0.551	0.746	8.896E-42	816	0.197	0.277	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5EBH1	0.0	1248	1074	0.533	0.569	TAT5_CAEEL Probable phospholipid-transporting ATPase tat-5 OS=Caenorhabditis elegans OX=6239 GN=tat-5 PE=1 SV=1
2	O43861	0.0	2388	1147	1.000	1.000	ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens OX=9606 GN=ATP9B PE=2 SV=4
3	O75110	0.0	1664	1047	0.690	0.755	ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens OX=9606 GN=ATP9A PE=1 SV=3
4	P40527	0.0	996	1151	0.450	0.448	ATC7_YEAST Phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NEO1 PE=1 SV=1
5	Q10309	0.0	910	1033	0.422	0.469	ATC7_SCHPO Phospholipid-transporting ATPase neo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=neo1 PE=3 SV=1
6	Q581T0	0.0	800	1080	0.384	0.407	Q581T0_TRYB2 Phospholipid-transporting ATPase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.780 PE=3 SV=1
7	F4K8T6	1.05e-151	485	1139	0.297	0.299	F4K8T6_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=ALA2 PE=1 SV=1
8	Q9Y2G3	6.21e-142	460	1177	0.287	0.280	AT11B_HUMAN Phospholipid-transporting ATPase IF OS=Homo sapiens OX=9606 GN=ATP11B PE=1 SV=2
9	P98197	1.49e-139	454	1187	0.289	0.279	AT11A_MOUSE Phospholipid-transporting ATPase IH OS=Mus musculus OX=10090 GN=Atp11a PE=1 SV=1
10	A0A8I6AVY6	1.69e-138	451	1164	0.276	0.272	A0A8I6AVY6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
11	Q9Y2Q0	1.75e-136	445	1164	0.269	0.265	AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens OX=9606 GN=ATP8A1 PE=1 SV=1
12	A0A8I5ZXX6	1.84e-136	445	1164	0.274	0.270	A0A8I5ZXX6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
13	Q9XIE6	8.18e-136	445	1213	0.285	0.270	ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana OX=3702 GN=ALA3 PE=1 SV=2
14	P70704	8.61e-136	443	1164	0.272	0.268	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
15	P98196	6.17e-135	441	1134	0.279	0.282	AT11A_HUMAN Phospholipid-transporting ATPase IH OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=3
16	E9PEJ6	2.70e-134	440	1191	0.279	0.269	E9PEJ6_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
17	Q9U280	9.35e-134	437	1139	0.284	0.286	TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans OX=6239 GN=tat-1 PE=1 SV=3
18	Q8TF62	3.17e-132	434	1192	0.298	0.287	AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens OX=9606 GN=ATP8B4 PE=1 SV=3
19	A3FIN4	5.55e-132	434	1183	0.297	0.288	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
20	Q5B018	4.39e-131	435	1348	0.299	0.254	Q5B018_EMENI Phospholipid-transporting ATPase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06112 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	3.5e-05	35.1	Cation transport ATPase (P-type)
2	PF00122 E1-E2_ATPase	4.7e-10	50.8	E1-E2 ATPase
3	PF13807 GNVR	1.1e+02	14.2	G-rich domain on putative tyrosine kinase
4	PF00702 Hydrolase	2.4e-10	52.6	haloacid dehalogenase-like hydrolase
5	PF08282 Hydrolase_3	8	17.7	haloacid dehalogenase-like hydrolase
6	PF16212 PhoLip_ATPase_C	3e-49	179.6	Phospholipid-translocating P-type ATPase C-terminal
7	PF16209 PhoLip_ATPase_N	1.6e-15	67.9	Phospholipid-translocating ATPase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398076

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230461	0.786	Cell cycle control protein 50A
2	9606.ENSP00000380880	0.780	PQ-loop repeat-containing protein 1
3	9606.ENSP00000419663	0.762	Cell cycle control protein 50C
4	9606.ENSP00000450842	0.697	Cell cycle control protein 50B
5	9606.ENSP00000377250	0.683	Protein MON2 homolog
6	9606.ENSP00000319918	0.636	T-cell immunomodulatory protein
7	9606.ENSP00000341198	0.613	Neogenin
8	9606.ENSP00000023939	0.601	Protein RTF2 homolog
9	9606.ENSP00000216923	0.557	Zinc finger protein 64 homolog, isoforms 1 and 2
10	9606.ENSP00000387006	0.515	Pre-mRNA-splicing factor CWC22 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140657	1.000	ATP-dependent activity
GO:0005215	1.000	transporter activity
GO:0005515	1.000	protein binding
GO:0140303	0.904	intramembrane lipid transporter activity
GO:0140326	0.771	ATPase-coupled intramembrane lipid transporter activity
GO:0140327	0.683	flippase activity
GO:0005548	0.588	phospholipid transporter activity
GO:0015247	0.480	aminophospholipid flippase activity
GO:0140333	0.462	glycerophospholipid flippase activity
GO:0008525	0.321	phosphatidylcholine transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.986	biological regulation
GO:0009987	0.908	cellular process
GO:0050789	0.859	regulation of biological process
GO:0050794	0.826	regulation of cellular process
GO:0032879	0.734	regulation of localization
GO:0051049	0.573	regulation of transport
GO:0051179	0.420	localization
GO:0006810	0.352	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005794	0.992	Golgi apparatus
GO:0016020	0.970	membrane
GO:0031984	0.926	organelle subcompartment
GO:0005886	0.917	plasma membrane
GO:0031090	0.896	organelle membrane
GO:0031982	0.880	vesicle
GO:0098791	0.865	Golgi apparatus subcompartment
GO:0005802	0.864	trans-Golgi network
GO:0031410	0.842	cytoplasmic vesicle
GO:0048471	0.772	perinuclear region of cytoplasm
GO:0030659	0.667	cytoplasmic vesicle membrane
GO:0098588	0.592	bounding membrane of organelle
GO:0032991	0.330	protein-containing complex
GO:0010008	0.301	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	0.771	P-type phospholipid transporter.

[back to server]