StarFunc result for job id O43889

User Input

>input (371 residues)
MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSP
PASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARL
VLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLES
RVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCL
LLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDC
VLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGS
PSVILQDRYSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43889	0.999	0.999	1.273E-55	371	1.000	1.000	O43889.pdb.gz	CREB3_HUMAN Cyclic AMP-responsive element-binding protein 3 OS=Homo sapiens OX=9606 GN=CREB3 PE=1 SV=2
2	AFDB:Q61817	0.442	0.407	1.064E-30	404	0.674	0.619	Q61817.pdb.gz	CREB3_MOUSE Cyclic AMP-responsive element-binding protein 3 OS=Mus musculus OX=10090 GN=Creb3 PE=2 SV=2
3	AFDB:Q8TEY5	0.374	0.353	1.226E-13	395	0.283	0.266	Q8TEY5.pdb.gz	CR3L4_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Homo sapiens OX=9606 GN=CREB3L4 PE=1 SV=1
4	AFDB:Q6QDP7	0.300	0.221	2.050E-7	521	0.245	0.175	Q6QDP7.pdb.gz	CR3L2_RAT Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Rattus norvegicus OX=10116 GN=Creb3l2 PE=2 SV=1
5	AFDB:Q960X8	0.201	0.106	5.830E-4	760	0.175	0.086	Q960X8.pdb.gz	HRS_DROME Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Drosophila melanogaster OX=7227 GN=Hrs PE=1 SV=1
6	AFDB:O88811	0.084	0.066	1.630E-3	523	0.148	0.105	O88811.pdb.gz	STAM2_MOUSE Signal transducing adapter molecule 2 OS=Mus musculus OX=10090 GN=Stam2 PE=1 SV=1
7	AFDB:P70297	0.082	0.059	2.297E-3	548	0.197	0.133	P70297.pdb.gz	STAM1_MOUSE Signal transducing adapter molecule 1 OS=Mus musculus OX=10090 GN=Stam PE=1 SV=3
8	AFDB:A0A2R8RRI1	0.082	0.064	5.230E-3	493	0.199	0.150	A0A2R8RRI1.pdb.gz	A0A2R8RRI1_DANRE Transcription factor EB OS=Danio rerio OX=7955 GN=tfeb PE=3 SV=1
9	AFDB:O75886	0.111	0.082	5.230E-3	525	0.148	0.105	O75886.pdb.gz	STAM2_HUMAN Signal transducing adapter molecule 2 OS=Homo sapiens OX=9606 GN=STAM2 PE=1 SV=1
10	AFDB:F1LY25	0.097	0.071	2.061E-2	821	0.137	0.062	F1LY25.pdb.gz	F1LY25_RAT Potassium voltage-gated channel subfamily Q member 5 OS=Rattus norvegicus OX=10116 GN=Kcnq5 PE=1 SV=4
11	PDB:5oayA	0.068	0.238	1.492	76	0.024	0.118	5oayA.pdb.gz	Structure of a Wbl protein and implications for NO sensing by M. tuberculosis.
12	PDB:4x6gE	0.091	0.108	2.582	307	0.024	0.029	4x6gE.pdb.gz
13	PDB:3szpA	0.089	0.109	3.171	290	0.027	0.034	3szpA.pdb.gz
14	PDB:3ispB	0.081	0.109	5.124	263	0.024	0.034	3ispB.pdb.gz
15	PDB:5wlcNB	0.070	0.134	6.741	142	0.035	0.092	5wlcNB.pdb.gz	The complete structure of the small-subunit processome.
16	PDB:6sgaF7	0.052	0.031	7.220	662	0.038	0.021	6sgaF7.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
17	PDB:7vhpG	0.190	0.227	8.281	299	0.035	0.043	7vhpG.pdb.gz
18	PDB:7wi3B	0.151	0.177	8.868	275	0.043	0.058	7wi3B.pdb.gz
19	PDB:6hivAb	0.054	0.047	9.498	453	0.038	0.031	6hivAb.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:7r6kJ	0.048	0.271	9.498	58	0.035	0.224	7r6kJ.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43889	0.0	744	371	1.000	1.000	CREB3_HUMAN Cyclic AMP-responsive element-binding protein 3 OS=Homo sapiens OX=9606 GN=CREB3 PE=1 SV=2
2	Q61817	3.73e-135	393	404	0.674	0.619	CREB3_MOUSE Cyclic AMP-responsive element-binding protein 3 OS=Mus musculus OX=10090 GN=Creb3 PE=2 SV=2
3	Q8TEY5	5.57e-45	161	395	0.224	0.210	CR3L4_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Homo sapiens OX=9606 GN=CREB3L4 PE=1 SV=1
4	Q68CJ9	5.53e-44	160	461	0.208	0.167	CR3L3_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Homo sapiens OX=9606 GN=CREB3L3 PE=1 SV=2
5	Q91XE9	4.10e-42	155	479	0.208	0.161	CR3L3_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Mus musculus OX=10090 GN=Creb3l3 PE=1 SV=1
6	Q9D2A5	4.45e-42	152	370	0.229	0.230	CR3L4_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Mus musculus OX=10090 GN=Creb3l4 PE=1 SV=1
7	Q66HA2	8.54e-23	101	520	0.178	0.127	CR3L1_RAT Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Creb3l1 PE=2 SV=1
8	Q9Z125	9.17e-23	101	519	0.178	0.127	CR3L1_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Mus musculus OX=10090 GN=Creb3l1 PE=1 SV=2
9	Q96BA8	3.18e-22	100	519	0.175	0.125	CR3L1_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Homo sapiens OX=9606 GN=CREB3L1 PE=1 SV=1
10	O44743	1.17e-19	92.8	690	0.156	0.084	LE607_CAEEL CREB-H transcription factor homolog let-607 OS=Caenorhabditis elegans OX=6239 GN=let-607 PE=2 SV=2
11	A1L224	4.27e-19	90.9	519	0.170	0.121	CR3L2_DANRE Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Danio rerio OX=7955 GN=creb3l2 PE=2 SV=1
12	Q4JFH9	3.54e-18	87.0	351	0.121	0.128	CRH2_CAEEL CREB homolog crh-2 OS=Caenorhabditis elegans OX=6239 GN=crh-2 PE=2 SV=3
13	Q6QDP7	4.23e-17	84.7	521	0.181	0.129	CR3L2_RAT Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Rattus norvegicus OX=10116 GN=Creb3l2 PE=2 SV=1
14	Q8BH52	5.61e-17	84.3	521	0.181	0.129	CR3L2_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Mus musculus OX=10090 GN=Creb3l2 PE=1 SV=1
15	Q70SY1	1.21e-16	83.6	520	0.178	0.127	CR3L2_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Homo sapiens OX=9606 GN=CREB3L2 PE=1 SV=3
16	P29747	3.25e-16	82.0	516	0.151	0.109	CREBA_DROME Cyclic AMP response element-binding protein A OS=Drosophila melanogaster OX=7227 GN=CrebA PE=1 SV=2
17	O35451	6.27e-07	53.5	699	0.108	0.057	ATF6B_MOUSE Cyclic AMP-dependent transcription factor ATF-6 beta OS=Mus musculus OX=10090 GN=Atf6b PE=1 SV=1
18	Q54WN7	7.58e-07	53.5	631	0.108	0.063	BZPF_DICDI Probable basic-leucine zipper transcription factor F OS=Dictyostelium discoideum OX=44689 GN=bzpF PE=3 SV=1
19	Q99941	9.09e-07	53.1	703	0.100	0.053	ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=2
20	Q6ZDF3	4.53e-05	47.4	374	0.078	0.078	TRAB1_ORYSJ bZIP transcription factor TRAB1 OS=Oryza sativa subsp. japonica OX=39947 GN=TRAB1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	7.5e-08	43.7	bZIP transcription factor
2	PF07716 bZIP_2	0.0002	32.7	Basic region leucine zipper
3	PF03131 bZIP_Maf	1.7	20.5	bZIP Maf transcription factor
4	PF14839 DOR	93	14.3	DOR family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342136

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309555	0.994	Host cell factor 1
2	9606.ENSP00000479618	0.972	Myc proto-oncogene protein
3	9606.ENSP00000254227	0.960	Nuclear receptor subfamily 0 group B member 2
4	9606.ENSP00000296953	0.958	CREB3 regulatory factor
5	9606.ENSP00000368798	0.958	Membrane-bound transcription factor site-2 protease
6	9606.ENSP00000344223	0.954	Membrane-bound transcription factor site-1 protease
7	9606.ENSP00000336790	0.920	Cyclic AMP-dependent transcription factor ATF-4
8	9606.ENSP00000329140	0.919	Cyclic AMP-responsive element-binding protein 3-like protein 2
9	9606.ENSP00000360266	0.917	Transcription factor AP-1
10	9606.ENSP00000297581	0.910	Dendritic cell-specific transmembrane protein
11	9606.ENSP00000387699	0.909	Cyclic AMP-responsive element-binding protein 1
12	9606.ENSP00000078445	0.906	Cyclic AMP-responsive element-binding protein 3-like protein 3
13	9606.ENSP00000252996	0.896	Transcription initiation factor TFIID subunit 4
14	9606.ENSP00000357596	0.889	Cyclic AMP-responsive element-binding protein 3-like protein 4
15	9606.ENSP00000264110	0.887	Cyclic AMP-dependent transcription factor ATF-2
16	9606.ENSP00000481956	0.884	Cyclic AMP-responsive element-binding protein 3-like protein 1
17	9606.ENSP00000296140	0.876	C-C chemokine receptor type 1
18	9606.ENSP00000350359	0.866	Cyclic AMP-responsive element-binding protein 5
19	9606.ENSP00000298307	0.863	Kelch domain-containing protein 2
20	9606.ENSP00000263253	0.846	Histone acetyltransferase p300

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001216	0.999	DNA-binding transcription activator activity
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.995	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.994	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0140297	0.991	DNA-binding transcription factor binding
GO:0000987	0.985	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.982	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042802	0.980	identical protein binding
GO:0046983	0.967	protein dimerization activity
GO:0042803	0.867	protein homodimerization activity
GO:0003682	0.774	chromatin binding
GO:0001221	0.755	transcription coregulator binding
GO:0048020	0.733	CCR chemokine receptor binding
GO:0061629	0.565	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0031726	0.552	CCR1 chemokine receptor binding
GO:0008140	0.533	cAMP response element binding protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.996	regulation of gene expression
GO:2001141	0.996	regulation of RNA biosynthetic process
GO:0009987	0.995	cellular process
GO:0009893	0.995	positive regulation of metabolic process
GO:0010604	0.992	positive regulation of macromolecule metabolic process
GO:0050896	0.989	response to stimulus
GO:0031325	0.979	positive regulation of cellular metabolic process
GO:0006355	0.975	regulation of DNA-templated transcription
GO:0051173	0.974	positive regulation of nitrogen compound metabolic process
GO:0048519	0.972	negative regulation of biological process
GO:0048523	0.964	negative regulation of cellular process
GO:1902680	0.962	positive regulation of RNA biosynthetic process
GO:0045893	0.954	positive regulation of DNA-templated transcription
GO:0048583	0.952	regulation of response to stimulus
GO:0006357	0.944	regulation of transcription by RNA polymerase II
GO:0007165	0.918	signal transduction
GO:0042221	0.911	response to chemical
GO:0034976	0.890	response to endoplasmic reticulum stress
GO:0070887	0.882	cellular response to chemical stimulus
GO:0045944	0.882	positive regulation of transcription by RNA polymerase II
GO:0071310	0.857	cellular response to organic substance
GO:0080135	0.827	regulation of cellular response to stress
GO:0008152	0.778	metabolic process
GO:1905897	0.767	regulation of response to endoplasmic reticulum stress
GO:0071704	0.757	organic substance metabolic process
GO:0009966	0.719	regulation of signal transduction
GO:0044237	0.695	cellular metabolic process
GO:0048585	0.691	negative regulation of response to stimulus
GO:1903573	0.679	negative regulation of response to endoplasmic reticulum stress
GO:0044238	0.642	primary metabolic process
GO:0043170	0.618	macromolecule metabolic process
GO:0006807	0.602	nitrogen compound metabolic process
GO:0006986	0.432	response to unfolded protein
GO:0034620	0.408	cellular response to unfolded protein
GO:0010941	0.401	regulation of cell death
GO:0030968	0.363	endoplasmic reticulum unfolded protein response
GO:0043067	0.339	regulation of programmed cell death
GO:1902531	0.333	regulation of intracellular signal transduction
GO:0042981	0.319	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	1.000	organelle membrane
GO:0005783	1.000	endoplasmic reticulum
GO:0005654	1.000	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0005829	0.998	cytosol
GO:0005794	0.978	Golgi apparatus
GO:0140513	0.968	nuclear protein-containing complex
GO:0031984	0.962	organelle subcompartment
GO:0098588	0.960	bounding membrane of organelle
GO:0005667	0.949	transcription regulator complex
GO:0090575	0.931	RNA polymerase II transcription regulator complex
GO:0098827	0.924	endoplasmic reticulum subcompartment
GO:0000139	0.912	Golgi membrane
GO:0005789	0.904	endoplasmic reticulum membrane
GO:0016604	0.510	nuclear body
GO:0036477	0.480	somatodendritic compartment
GO:0044297	0.335	cell body
GO:0043025	0.313	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]