StarFunc result for job id O43896

User Input

>input (1103 residues)
MAGASVKVAVRVRPFNARETSQDAKCVVSMQGNTTSIINPKQSKDAPKSFTFDYSYWSHT
STEDPQFASQQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQEPGQQGIVP
QLCEDLFSRVSENQSAQLSYSVEVSYMEIYCERVRDLLNPKSRGSLRVREHPILGPYVQD
LSKLAVTSYADIADLMDCGNKARTVAATNMNETSSRSHAVFTIVFTQRCHDQLTGLDSEK
VSKISLVDLAGSERADSSGARGMRLKEGANINKSLTTLGKVISALADMQSKKRKSDFIPY
RDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRTKQIRCNAIINEDPNA
RLIRELQEEVARLRELLMAQGLSASALEGLKTEEGSVRGALPAVSSPPAPVSPSSPTTHN
GELEPSFSPNTESQIGPEEAMERLQETEKIIAELNETWEEKLRKTEALRMEREALLAEMG
VAVREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYHIKDGVTRVGQVDMDIKLTGQFIR
EQHCLFRSIPQPDGEVVVTLEPCEGAETYVNGKLVTEPLVLKSGNRIVMGKNHVFRFNHP
EQARLERERGVPPPPGPPSEPVDWNFAQKELLEQQGIDIKLEMEKRLQDLENQYRKEKEE
ADLLLEQQRLYADSDSGDDSDKRSCEESWRLISSLREQLPPTTVQTIVKRCGLPSSGKRR
APRRVYQIPQRRRLQGKDPRWATMADLKMQAVKEICYEVALADFRHGRAEIEALAALKMR
ELCRTYGKPDGPGDAWRAVARDVWDTVGEEEGGGAGSGGGSEEGARGAEVEDLRAHIDKL
TGILQEVKLQNSSKDRELQALRDRMLRMERVIPLAQDHEDENEEGGEVPWAPPEGSEAAE
EAAPSDRMPSARPPSPPLSSWERVSRLMEEDPAFRRGRLRWLKQEQLRLQGLQGSGGRGG
GLRRPPARFVPPHDCKLRFPFKSNPQHRESWPGMGSGEAPTPLQPPEEVTPHPATPARRP
PSPRRSHHPRRNSLDGGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPP
YTTPPRMRRQRSAPDLKESGAAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QJ64	0.472	0.450	0.000	1161	0.654	0.621	F1QJ64.pdb.gz	F1QJ64_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
2	AFDB:O43896	0.999	0.999	0.000	1103	1.000	1.000	O43896.pdb.gz	KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3
3	AFDB:F1M4A4	0.514	0.343	6.330E-98	1707	0.461	0.298	F1M4A4.pdb.gz	KIF1A_RAT Kinesin-like protein KIF1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=3
4	AFDB:O60333	0.329	0.202	2.948E-96	1816	0.495	0.301	O60333.pdb.gz	KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5
5	AFDB:A1ZAJ2	0.318	0.213	1.964E-86	1670	0.398	0.263	A1ZAJ2.pdb.gz	KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1
6	AFDB:P23678	0.514	0.367	1.133E-84	1584	0.356	0.248	P23678.pdb.gz	UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=unc-104 PE=1 SV=4
7	AFDB:Q15058	0.442	0.300	1.070E-65	1648	0.296	0.198	Q15058.pdb.gz	KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens OX=9606 GN=KIF14 PE=1 SV=1
8	AFDB:B1AVY7	0.311	0.263	1.924E-65	1312	0.319	0.268	B1AVY7.pdb.gz	KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus OX=10090 GN=Kif16b PE=1 SV=1
9	AFDB:Q96L93	0.311	0.261	4.518E-65	1317	0.296	0.248	Q96L93.pdb.gz	KI16B_HUMAN Kinesin-like protein KIF16B OS=Homo sapiens OX=9606 GN=KIF16B PE=1 SV=2
10	AFDB:L0N7N1	0.447	0.301	2.470E-63	1674	0.286	0.189	L0N7N1.pdb.gz	KIF14_MOUSE Kinesin-like protein KIF14 OS=Mus musculus OX=10090 GN=Kif14 PE=1 SV=1
11	PDB:7wrgA	0.428	0.569	9.970E-55	812	0.226	0.307	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.417	0.573	2.068E-52	783	0.218	0.308	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.248	0.400	6.864E-24	670	0.094	0.155	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:2ff4A	0.081	0.227	2.939E-6	379	0.036	0.106	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
15	PDB:7dvqX	0.086	0.546	3.269E-6	156	0.027	0.192	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:5gm6U	0.091	0.519	3.804E-5	176	0.016	0.102	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:5z56X	0.081	0.489	3.944E-3	159	0.018	0.126	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
18	PDB:7dysA	0.058	0.124	3.514E-2	387	0.031	0.088	7dysA.pdb.gz
19	PDB:5w3sA	0.045	0.086	5.992E-2	485	0.025	0.058	5w3sA.pdb.gz	Cryo-electron microscopy structure of the lysosomal calcium-permeable channel TRPML3.
20	PDB:1m2vA	0.072	0.093	1.022E-1	705	0.044	0.070	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A6V5	0.0	1004	1697	0.459	0.298	A0A8I6A6V5_RAT Kinesin family member 1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=1
2	A1ZAJ2	0.0	848	1670	0.385	0.254	KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1
3	E9QDE5	0.0	1008	1763	0.446	0.279	E9QDE5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
4	F1M4A4	0.0	1004	1707	0.461	0.298	KIF1A_RAT Kinesin-like protein KIF1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=3
5	F1QBV5	0.0	1008	1770	0.446	0.278	F1QBV5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
6	F1QJ64	0.0	1355	1161	0.661	0.628	F1QJ64_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
7	O35071	0.0	1885	1100	0.930	0.933	KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus OX=10090 GN=Kif1c PE=1 SV=2
8	O35787	0.0	1826	1097	0.927	0.932	KIF1C_RAT Kinesin-like protein KIF1C OS=Rattus norvegicus OX=10116 GN=Kif1c PE=1 SV=1
9	O43896	0.0	2268	1103	1.000	1.000	KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3
10	O60333	0.0	1007	1816	0.458	0.278	KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5
11	O88658	0.0	996	1816	0.457	0.278	KIF1B_RAT Kinesin-like protein KIF1B OS=Rattus norvegicus OX=10116 GN=Kif1b PE=1 SV=2
12	P23678	0.0	758	1584	0.361	0.251	UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=unc-104 PE=1 SV=4
13	P33173	0.0	1001	1695	0.458	0.298	KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus OX=10090 GN=Kif1a PE=1 SV=2
14	Q12756	0.0	1000	1690	0.456	0.298	KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens OX=9606 GN=KIF1A PE=1 SV=2
15	Q5AVY3	0.0	630	1630	0.292	0.198	Q5AVY3_EMENI Kinesin family protein (AFU_orthologue AFUA_2G14730) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=uncA PE=3 SV=1
16	Q60575	0.0	1000	1816	0.458	0.278	KIF1B_MOUSE Kinesin-like protein KIF1B OS=Mus musculus OX=10090 GN=Kif1b PE=1 SV=2
17	Q9NGQ2	0.0	601	2205	0.309	0.155	KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium discoideum OX=44689 GN=kif1 PE=1 SV=1
18	A4UZI0	5.70e-175	563	1899	0.289	0.168	A4UZI0_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
19	A0A0B4LGK5	7.93e-175	563	1913	0.289	0.167	A0A0B4LGK5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
20	A1ZA18	9.32e-175	563	1921	0.289	0.166	A1ZA18_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	0.041	25.6	FHA domain
2	PF00225 Kinesin	1.2e-109	377.8	Kinesin motor domain
3	PF16183 Kinesin_assoc	2.6e-66	234.7	Kinesin-associated
4	PF16796 Microtub_bd	4.2e-19	80.5	Microtubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320821

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380690	0.915	BICD family-like cargo adapter 1
2	9606.ENSP00000459943	0.913	Rabankyrin-5
3	9606.ENSP00000452414	0.911	Protein tyrosine phosphatase, non-receptor type 21
4	9606.ENSP00000305699	0.897	Protein Hook homolog 3
5	9606.ENSP00000264335	0.778	14-3-3 protein epsilon
6	9606.ENSP00000354560	0.754	Kinesin-associated protein 3
7	9606.ENSP00000399403	0.734	Kinesin light chain 2
8	9606.ENSP00000410964	0.724	Erlin-1
9	9606.ENSP00000339479	0.717	Cytosolic purine 5'-nucleotidase
10	9606.ENSP00000306330	0.713	14-3-3 protein gamma
11	9606.ENSP00000375810	0.712	Kinesin light chain 3
12	9606.ENSP00000259708	0.708	Kinesin light chain 4
13	9606.ENSP00000311449	0.707	Ras-related protein Rab-6A
14	9606.ENSP00000414982	0.700	Kinesin light chain 1
15	9606.ENSP00000361930	0.698	14-3-3 protein beta/alpha
16	9606.ENSP00000354848	0.677	KIF1-binding protein
17	9606.ENSP00000349351	0.668	Protein bicaudal D homolog 2
18	9606.ENSP00000361845	0.649	CAAX prenyl protease 1 homolog
19	9606.ENSP00000408979	0.621	Kinesin heavy chain isoform 5A
20	9606.ENSP00000307078	0.618	Kinesin-1 heavy chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003774	0.999	cytoskeletal motor activity
GO:0005515	0.999	protein binding
GO:1901363	0.991	heterocyclic compound binding
GO:0097159	0.990	organic cyclic compound binding
GO:0003676	0.886	nucleic acid binding
GO:0003723	0.866	RNA binding
GO:0003777	0.649	microtubule motor activity
GO:0019899	0.591	enzyme binding
GO:0008092	0.305	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0051179	0.983	localization
GO:0051234	0.960	establishment of localization
GO:0006810	0.948	transport
GO:0048193	0.915	Golgi vesicle transport
GO:0006890	0.886	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0007017	0.831	microtubule-based process
GO:0051641	0.639	cellular localization
GO:0051649	0.622	establishment of localization in cell
GO:0065007	0.515	biological regulation
GO:0050794	0.491	regulation of cellular process
GO:0007018	0.433	microtubule-based movement
GO:0016043	0.368	cellular component organization
GO:0046907	0.356	intracellular transport
GO:0051640	0.346	organelle localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0043228	0.995	non-membrane-bounded organelle
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0032991	0.987	protein-containing complex
GO:0005829	0.951	cytosol
GO:0015630	0.943	microtubule cytoskeleton
GO:0005794	0.926	Golgi apparatus
GO:0016020	0.835	membrane
GO:0005783	0.470	endoplasmic reticulum
GO:0005875	0.326	microtubule associated complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]