StarFunc result for job id O43897

User Input

>input (1013 residues)
MGLGTLSPRMLVWLVASGIVFYGELWVCAGLDYDYTFDGNEEDKTETIDYKDPCKAAVFW
GDIALDDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKRGALYQLIDRIRRIGF
GLEQNNTVKGKVPLQFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQ
AMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVH
ELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYA
RNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGNL
SSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLL
GRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPD
DYRPMKECVWKITVSESYHVGLTFQSFEIERHDNCAYDYLEVRDGTSENSPLIGRFCGYD
KPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCA
CEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKF
EFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTVSK
KGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHS
PSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETE
KSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDL
YSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAV
GLGRFCGSGPPEEIYSIGDSVLIHFHTDDTINKKGFHIRYKSIRYPDTTHTKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QEK5	0.757	0.776	0.000	986	0.707	0.726	A0A2R8QEK5.pdb.gz
2	AFDB:O43897	1.000	1.000	0.000	1013	1.000	1.000	O43897.pdb.gz	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
3	AFDB:O57460	0.563	0.558	0.000	1022	0.811	0.804	O57460.pdb.gz	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
4	AFDB:P25723	0.447	0.426	0.000	1067	0.424	0.403	P25723.pdb.gz	TLD_DROME Dorsal-ventral patterning protein tolloid OS=Drosophila melanogaster OX=7227 GN=tld PE=2 SV=2
5	AFDB:P98063	0.527	0.539	0.000	991	0.713	0.729	P98063.pdb.gz	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
6	AFDB:P98070	0.570	0.796	0.000	707	0.508	0.728	P98070.pdb.gz	BMP1_XENLA Bone morphogenetic protein 1 OS=Xenopus laevis OX=8355 GN=bmp1 PE=1 SV=1
7	AFDB:Q8JI28	0.750	0.754	0.000	1007	0.852	0.857	Q8JI28.pdb.gz	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
8	AFDB:Q9VC47	0.566	0.400	0.000	1464	0.473	0.327	Q9VC47.pdb.gz	TOK_DROME Protein tolkin OS=Drosophila melanogaster OX=7227 GN=tok PE=1 SV=1
9	AFDB:Q9Y6L7	0.665	0.664	0.000	1015	0.723	0.721	Q9Y6L7.pdb.gz	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
10	AFDB:B3DFP6	0.128	0.136	4.752E-33	927	0.143	0.156	B3DFP6.pdb.gz
11	PDB:7b01A	0.092	0.144	4.806E-11	588	0.041	0.071	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
12	PDB:7ufgA	0.096	0.086	2.607E-8	1151	0.101	0.089	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
13	PDB:8a7eC	0.106	0.082	6.582E-7	1524	0.101	0.067	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
14	PDB:1kcwA	0.058	0.058	1.398E-6	1017	0.072	0.072	1kcwA.pdb.gz	The X-ray structure of human serum ceruloplasmin at 3.1 angstrom: Nature of the copper centres.
15	PDB:7kveB	0.087	0.070	1.931E-6	1374	0.076	0.056	7kveB.pdb.gz
16	PDB:4bxsV	0.068	0.061	2.150E-6	1262	0.064	0.052	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
17	PDB:7ufgB	0.093	0.082	3.887E-6	1182	0.096	0.082	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
18	PDB:3fu7B	0.065	0.102	1.203E-5	559	0.038	0.070	3fu7B.pdb.gz	Structure Function Studies of a Melanocarpus albomyces Laccase Suggest a Pathway for Oxidation of Phenolic Compounds.
19	PDB:6vlsD	0.088	0.091	1.414E-5	963	0.044	0.047	6vlsD.pdb.gz
20	PDB:5eiyB	0.082	0.114	1.953E-5	658	0.041	0.064	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M798	0.0	1548	990	0.706	0.722	F1M798_RAT Metalloendopeptidase OS=Rattus norvegicus OX=10116 GN=Bmp1 PE=4 SV=2
2	F1REM3	0.0	1540	976	0.701	0.727	F1REM3_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=4 SV=2
3	O43897	0.0	2118	1013	1.000	1.000	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
4	O57460	0.0	1759	1022	0.814	0.807	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
5	P13497	0.0	1548	986	0.707	0.726	BMP1_HUMAN Bone morphogenetic protein 1 OS=Homo sapiens OX=9606 GN=BMP1 PE=1 SV=2
6	P25723	0.0	839	1067	0.405	0.384	TLD_DROME Dorsal-ventral patterning protein tolloid OS=Drosophila melanogaster OX=7227 GN=tld PE=2 SV=2
7	P98063	0.0	1549	991	0.709	0.725	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
8	P98070	0.0	1104	707	0.504	0.723	BMP1_XENLA Bone morphogenetic protein 1 OS=Xenopus laevis OX=8355 GN=bmp1 PE=1 SV=1
9	Q2ABP1	0.0	1533	986	0.701	0.720	Q2ABP1_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=2 SV=1
10	Q62381	0.0	2001	1013	0.936	0.936	TLL1_MOUSE Tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Tll1 PE=1 SV=1
11	Q8JI28	0.0	1833	1007	0.853	0.858	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
12	Q9VC47	0.0	987	1464	0.455	0.315	TOK_DROME Protein tolkin OS=Drosophila melanogaster OX=7227 GN=tok PE=1 SV=1
13	Q9WVM6	0.0	1550	1012	0.707	0.708	TLL2_MOUSE Tolloid-like protein 2 OS=Mus musculus OX=10090 GN=Tll2 PE=1 SV=1
14	Q9Y6L7	0.0	1567	1015	0.714	0.712	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
15	Q49IK4	4.32e-126	391	422	0.186	0.445	Q49IK4_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
16	Q49IJ0	4.37e-126	391	422	0.186	0.445	Q49IJ0_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
17	Q49II7	5.29e-126	391	422	0.186	0.445	Q49II7_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
18	Q49II8	5.52e-126	391	422	0.186	0.445	Q49II8_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
19	Q49IJ1	5.82e-126	391	422	0.186	0.445	Q49IJ1_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
20	Q49II0	6.20e-126	391	422	0.186	0.445	Q49II0_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01400 Astacin	4.9e-69	243.3	Astacin (Peptidase family M12A)
2	PF12662 cEGF	3.6e-06	38.1	Complement Clr-like EGF-like
3	PF00431 CUB	6.5e-184	610.8	CUB domain
4	PF02408 CUB_2	0.74	21.0	CUB-like domain
5	PF00008 EGF	0.026	26.1	EGF-like domain
6	PF12947 EGF_3	0.037	25.5	EGF domain
7	PF07645 EGF_CA	1.7e-08	45.8	Calcium-binding EGF domain
8	PF14670 FXa_inhibition	7e-14	63.2	Coagulation Factor Xa inhibitory site
9	PF12661 hEGF	12	17.9	Human growth factor-like EGF
10	PF00413 Peptidase_M10	6.2	18.1	Matrixin
11	PF13583 Reprolysin_4	1.2e+02	13.7	Metallo-peptidase family M12B Reprolysin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000061240

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000204604	0.958	Chordin
2	9606.ENSP00000348385	0.948	Collagen alpha-1(XXVII) chain
3	9606.ENSP00000260702	0.931	Lysyl oxidase homolog 4
4	9606.ENSP00000364000	0.931	Collagen alpha-2(V) chain
5	9606.ENSP00000359603	0.929	Collagen alpha-1(XXIV) chain
6	9606.ENSP00000373783	0.927	Lysyl oxidase homolog 2
7	9606.ENSP00000363827	0.926	Basement membrane-specific heparan sulfate proteoglycan core protein
8	9606.ENSP00000225964	0.925	Collagen alpha-1(I) chain
9	9606.ENSP00000231004	0.925	Protein-lysine 6-oxidase
10	9606.ENSP00000261921	0.924	Lysyl oxidase homolog 1
11	9606.ENSP00000297268	0.924	Collagen alpha-2(I) chain
12	9606.ENSP00000359114	0.914	Collagen alpha-1(XI) chain
13	9606.ENSP00000369889	0.909	Collagen alpha-1(II) chain
14	9606.ENSP00000304408	0.908	Collagen alpha-1(III) chain
15	9606.ENSP00000332371	0.907	Collagen alpha-1(VII) chain
16	9606.ENSP00000360882	0.907	Collagen alpha-1(V) chain
17	9606.ENSP00000363840	0.905	Collagen alpha-2(XI) chain
18	9606.ENSP00000264828	0.904	Collagen alpha-3(V) chain
19	9606.ENSP00000264094	0.903	Lysyl oxidase homolog 3
20	9606.ENSP00000324532	0.682	Laminin subunit alpha-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008233	0.999	peptidase activity
GO:0005515	0.998	protein binding
GO:0004175	0.950	endopeptidase activity
GO:0008237	0.946	metallopeptidase activity
GO:0004222	0.867	metalloendopeptidase activity
GO:0004252	0.395	serine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.995	anatomical structure development
GO:0007275	0.991	multicellular organism development
GO:0009987	0.983	cellular process
GO:0071704	0.967	organic substance metabolic process
GO:0006807	0.955	nitrogen compound metabolic process
GO:1901564	0.953	organonitrogen compound metabolic process
GO:0044238	0.948	primary metabolic process
GO:0048731	0.946	system development
GO:0043170	0.930	macromolecule metabolic process
GO:0019538	0.921	protein metabolic process
GO:0001501	0.846	skeletal system development
GO:0071840	0.790	cellular component organization or biogenesis
GO:0016043	0.777	cellular component organization
GO:0050789	0.758	regulation of biological process
GO:0006508	0.704	proteolysis
GO:0045229	0.621	external encapsulating structure organization
GO:0043062	0.608	extracellular structure organization
GO:0030198	0.601	extracellular matrix organization
GO:0009953	0.528	dorsal/ventral pattern formation
GO:0097435	0.524	supramolecular fiber organization
GO:0048264	0.521	determination of ventral identity
GO:0033333	0.484	fin development
GO:0050794	0.463	regulation of cellular process
GO:0048513	0.426	animal organ development
GO:0030199	0.344	collagen fibril organization
GO:0009653	0.312	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.516	extracellular space
GO:0071944	0.411	cell periphery
GO:0043227	0.350	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.999	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.867	Metalloendopeptidases.
EC:3.4.21.-	0.395	Serine endopeptidases.

[back to server]