StarFunc result for job id O43900

User Input

>input (615 residues)
MFARGSRRRRSGRAPPEAEDPDRGQPCNSCREQCPGFLLHGWRKICQHCKCPREEHAVHA
VPVDLERIMCRLISDFQRHSISDDDSGCASEEYAWVPPGLKPEQVYQFFSCLPEDKVPYV
NSPGEKYRIKQLLHQLPPHDSEAQYCTALEEEEKKELRAFSQQRKRENLGRGIVRIFPVT
ITGAICEECGKQIGGGDIAVFASRAGLGACWHPQCFVCTTCQELLVDLIYFYHVGKVYCG
RHHAECLRPRCQACDEIIFSPECTEAEGRHWHMDHFCCFECEASLGGQRYVMRQSRPHCC
ACYEARHAEYCDGCGEHIGLDQGQMAYEGQHWHASDRCFCCSRCGRALLGRPFLPRRGLI
FCSRACSLGSEPTAPGPSRRSWSAGPVTAPLAASTASFSAVKGASETTTKGTSTELAPAT
GPEEPSRFLRGAPHRHSMPELGLRSVPEPPPESPGQPNLRPDDSAFGRQSTPRVSFRDPL
VSEGGPRRTLSAPPAQRRRPRSPPPRAPSRRRHHHHNHHHHHNRHPSRRRHYQCDAGSGS
DSESCSSSPSSSSSESSEDDGFFLGERIPLPPHLCRPMPAQDTAMETFNSPSLSLPRDSR
AGMPRQARDKNCIVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43900	0.999	0.999	0.000	615	1.000	1.000	O43900.pdb.gz	PRIC3_HUMAN Prickle planar cell polarity protein 3 OS=Homo sapiens OX=9606 GN=PRICKLE3 PE=1 SV=2
2	AFDB:Q80VL3	0.742	0.732	3.419E-101	624	0.894	0.881	Q80VL3.pdb.gz	PRIC3_MOUSE Prickle planar cell polarity protein 3 OS=Mus musculus OX=10090 GN=Prickle3 PE=1 SV=1
3	AFDB:A0A2R8Q2U1	0.581	0.399	1.292E-66	900	0.504	0.344	A0A2R8Q2U1.pdb.gz
4	AFDB:G5EDJ5	0.426	0.423	4.253E-36	619	0.221	0.220	G5EDJ5.pdb.gz	G5EDJ5_CAEEL LIM domain protein OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=2
5	PDB:4kfzB	0.115	0.381	1.696E-6	148	0.047	0.196	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
6	AFDB:P39083	0.129	0.086	1.168E-5	1007	0.109	0.067	P39083.pdb.gz	RGA1_YEAST Rho-type GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA1 PE=1 SV=1
7	PDB:1b8tA	0.095	0.269	2.719E-5	192	0.063	0.203	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
8	AFDB:Q9QXD8	0.175	0.162	4.402E-5	668	0.083	0.076	Q9QXD8.pdb.gz	LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus OX=10090 GN=Limd1 PE=1 SV=2
9	PDB:1imlA	0.094	0.616	5.115E-2	76	0.029	0.237	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
10	AFDB:A0A1D8PRQ6	0.150	0.074	1.607E-1	1468	0.063	0.027	A0A1D8PRQ6.pdb.gz	A0A1D8PRQ6_CANAL Lrg1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LRG1 PE=4 SV=1
11	AFDB:Q54Z52	0.098	0.075	2.452E-1	822	0.065	0.049	Q54Z52.pdb.gz	Q54Z52_DICDI Prespore-specific protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277777 PE=4 SV=1
12	AFDB:Q9P1Z0	0.060	0.046	1.690	1013	0.145	0.088	Q9P1Z0.pdb.gz	ZBTB4_HUMAN Zinc finger and BTB domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBTB4 PE=1 SV=3
13	PDB:4xr8H	0.063	0.187	2.286	151	0.024	0.099	4xr8H.pdb.gz	Structure of the E6/E6AP/p53 complex required for HPV-mediated degradation of p53.
14	PDB:6q2mA	0.040	0.042	2.740	544	0.021	0.024	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
15	PDB:3bwnB	0.061	0.091	2.910	369	0.020	0.033	3bwnB.pdb.gz	Rapid synthesis of auxin via a new tryptophan-dependent pathway is required for shade avoidance in plants
16	PDB:7obaA	0.052	0.034	2.910	1522	0.039	0.016	7obaA.pdb.gz	Cryo-EM structures of human RNA polymerase I.
17	PDB:7q3nU	0.073	0.118	2.910	292	0.028	0.058	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
18	PDB:4e0sB	0.047	0.038	3.487	898	0.036	0.024	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
19	PDB:7n9sA	0.072	0.031	3.487	2365	0.029	0.008	7n9sA.pdb.gz
20	AFDB:B8A5T9	0.065	0.047	7.632	927	0.109	0.072	B8A5T9.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43900	0.0	1249	615	1.000	1.000	PRIC3_HUMAN Prickle planar cell polarity protein 3 OS=Homo sapiens OX=9606 GN=PRICKLE3 PE=1 SV=2
2	Q7Z3G6	0.0	538	844	0.390	0.284	PRIC2_HUMAN Prickle-like protein 2 OS=Homo sapiens OX=9606 GN=PRICKLE2 PE=1 SV=2
3	Q80VL3	0.0	931	624	0.867	0.854	PRIC3_MOUSE Prickle planar cell polarity protein 3 OS=Mus musculus OX=10090 GN=Prickle3 PE=1 SV=1
4	Q80Y24	2.12e-180	534	845	0.389	0.283	PRIC2_MOUSE Prickle-like protein 2 OS=Mus musculus OX=10090 GN=Prickle2 PE=1 SV=3
5	F1REQ6	5.68e-180	533	840	0.374	0.274	F1REQ6_DANRE Prickle homolog 2b OS=Danio rerio OX=7955 GN=cb886 PE=3 SV=1
6	Q7ZZC4	6.19e-180	532	840	0.374	0.274	Q7ZZC4_DANRE Prickle-like protein 2 OS=Danio rerio OX=7955 GN=pk2 PE=2 SV=1
7	Q3U5C7	7.29e-158	475	832	0.337	0.249	PRIC1_MOUSE Prickle-like protein 1 OS=Mus musculus OX=10090 GN=Prickle1 PE=1 SV=1
8	Q96MT3	3.96e-157	473	831	0.337	0.249	PRIC1_HUMAN Prickle-like protein 1 OS=Homo sapiens OX=9606 GN=PRICKLE1 PE=1 SV=2
9	Q71QF9	1.10e-155	470	831	0.335	0.248	PRIC1_RAT Prickle-like protein 1 OS=Rattus norvegicus OX=10116 GN=Prickle1 PE=2 SV=2
10	Q90Z06	2.80e-155	469	835	0.327	0.241	PRI1A_XENLA Prickle-like protein 1-A OS=Xenopus laevis OX=8355 GN=prickle1-a PE=1 SV=1
11	F1Q6J9	1.85e-150	455	793	0.335	0.260	F1Q6J9_DANRE Prickle homolog 1a OS=Danio rerio OX=7955 GN=fk71b09 PE=3 SV=1
12	Q6WGK5	1.35e-149	453	793	0.333	0.259	Q6WGK5_DANRE Prickle homolog 1a OS=Danio rerio OX=7955 GN=pk1 PE=2 SV=1
13	Q5SP54	7.26e-146	445	863	0.324	0.231	Q5SP54_DANRE Prickle homolog 1b OS=Danio rerio OX=7955 GN=fb98c11 PE=3 SV=2
14	F2Z4V3	1.35e-145	445	872	0.324	0.228	F2Z4V3_DANRE Prickle homolog 1b OS=Danio rerio OX=7955 GN=fb98c11 PE=3 SV=1
15	Q9U1I1	2.65e-142	434	785	0.333	0.261	ESN_DROME Protein espinas OS=Drosophila melanogaster OX=7227 GN=esn PE=2 SV=1
16	A1Z6W3	8.08e-136	430	1299	0.314	0.149	PRIC1_DROME Protein prickle OS=Drosophila melanogaster OX=7227 GN=pk PE=1 SV=1
17	Q7ZXE9	1.49e-88	283	422	0.244	0.355	TES_XENLA Testin OS=Xenopus laevis OX=8355 GN=tes PE=2 SV=1
18	Q2LAP6	5.20e-87	279	419	0.242	0.356	TES_RAT Testin OS=Rattus norvegicus OX=10116 GN=Tes PE=1 SV=1
19	A4D0U5	4.90e-85	274	421	0.241	0.352	A4D0U5_HUMAN Testin OS=Homo sapiens OX=9606 GN=TES PE=3 SV=1
20	Q9UGI8	4.90e-85	274	421	0.241	0.352	TES_HUMAN Testin OS=Homo sapiens OX=9606 GN=TES PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00412 LIM	3.8e-18	76.8	LIM domain
2	PF06297 PET	4.1e-32	121.6	PET Domain
3	PF10500 SR-25	64	14.6	Nuclear RNA-splicing-associated protein
4	PF15337 Vasculin	2.5e+02	13.9	Vascular protein family Vasculin-like 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000470248

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357040	0.990	Vang-like protein 2
2	9606.ENSP00000347672	0.975	VANGL planar cell polarity protein 1
3	9606.ENSP00000005340	0.864	Segment polarity protein dishevelled homolog DVL-2
4	9606.ENSP00000368169	0.859	Segment polarity protein dishevelled homolog DVL-1
5	9606.ENSP00000316054	0.853	Segment polarity protein dishevelled homolog DVL-3
6	9606.ENSP00000430985	0.791	Ankyrin repeat domain-containing protein 6
7	9606.ENSP00000365441	0.730	Voltage-dependent L-type calcium channel subunit alpha-1F
8	9606.ENSP00000378167	0.671	Microtubule-binding protein required for ciliogenesis . May function in ciliogenesis by mediating the transport of proteins like BBS4 to the cilium, but also through the organization of the centriolar satellites . Plays a role in retina morphogenesis and/or homeostasis (By similarity).
9	9606.ENSP00000262738	0.669	Cadherin EGF LAG seven-pass G-type receptor 1
10	9606.ENSP00000271332	0.656	Cadherin EGF LAG seven-pass G-type receptor 2
11	9606.ENSP00000263233	0.648	Synaptophysin
12	9606.ENSP00000338207	0.619	Rhombotin-1
13	9606.ENSP00000164024	0.615	Cadherin EGF LAG seven-pass G-type receptor 3
14	9606.ENSP00000349320	0.615	Voltage-dependent calcium channel subunit alpha-2/delta-1
15	9606.ENSP00000234198	0.544	Homeobox protein DLX-2
16	9606.ENSP00000466953	0.518	Wilms tumor protein 1-interacting protein
17	9606.ENSP00000351605	0.512	Frizzled-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.994	multicellular organismal process
GO:0009987	0.987	cellular process
GO:0050794	0.917	regulation of cellular process
GO:0032502	0.906	developmental process
GO:0048856	0.902	anatomical structure development
GO:0007275	0.858	multicellular organism development
GO:0048731	0.853	system development
GO:0050896	0.633	response to stimulus
GO:0048518	0.619	positive regulation of biological process
GO:0048513	0.579	animal organ development
GO:0048522	0.517	positive regulation of cellular process
GO:0019222	0.468	regulation of metabolic process
GO:0071840	0.444	cellular component organization or biogenesis
GO:0060255	0.435	regulation of macromolecule metabolic process
GO:0016043	0.433	cellular component organization
GO:0031323	0.412	regulation of cellular metabolic process
GO:0080090	0.377	regulation of primary metabolic process
GO:0051171	0.376	regulation of nitrogen compound metabolic process
GO:0048583	0.375	regulation of response to stimulus
GO:0048519	0.370	negative regulation of biological process
GO:0023051	0.370	regulation of signaling
GO:0010646	0.365	regulation of cell communication
GO:0009966	0.363	regulation of signal transduction
GO:0010468	0.362	regulation of gene expression
GO:0048523	0.337	negative regulation of cellular process
GO:0051716	0.329	cellular response to stimulus
GO:0010604	0.302	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005739	0.992	mitochondrion
GO:0071944	0.388	cell periphery
GO:0016020	0.341	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]