StarFunc result for job id O43908

User Input

>input (158 residues)
MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYH
CKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHC
PEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07444	0.224	0.165	8.889E-13	240	0.778	0.512	Q07444.pdb.gz	NKG2E_HUMAN NKG2-E type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC3 PE=2 SV=3
2	AFDB:P26715	0.281	0.215	2.275E-10	233	0.614	0.416	P26715.pdb.gz	NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC1 PE=1 SV=2
3	AFDB:A6H5Z4	0.255	0.188	9.058E-4	244	0.380	0.246	A6H5Z4.pdb.gz	A6H5Z4_MOUSE Klrc1 protein OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
4	AFDB:A1L3Q6	0.266	0.183	1.276E-3	246	0.297	0.191	A1L3Q6.pdb.gz	A1L3Q6_MOUSE Klrc3 protein OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
5	AFDB:Q9P2T0	0.131	0.060	8.513E-1	379	0.139	0.058	Q9P2T0.pdb.gz	SPMA2_HUMAN Sperm microtubule associated protein 2 OS=Homo sapiens OX=9606 GN=SPMAP2 PE=1 SV=1
6	AFDB:F4JLC1	0.148	0.082	1.576	331	0.139	0.066	F4JLC1.pdb.gz	MRL7_ARATH Thioredoxin-like fold domain-containing protein MRL7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MRL7 PE=1 SV=1
7	AFDB:A0A1W2PS91	0.114	0.056	1.688	400	0.209	0.083	A0A1W2PS91.pdb.gz	A0A1W2PS91_HUMAN Paired box 6 OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
8	AFDB:Q8GWA7	0.155	0.077	1.688	349	0.114	0.052	Q8GWA7.pdb.gz	MCD1_ARATH Protein MULTIPLE CHLOROPLAST DIVISION SITE 1 OS=Arabidopsis thaliana OX=3702 GN=MCD1 PE=1 SV=1
9	AFDB:Q32KY1	0.270	0.065	3.584	712	0.108	0.024	Q32KY1.pdb.gz	DRC1_BOVIN Dynein regulatory complex protein 1 OS=Bos taurus OX=9913 GN=DRC1 PE=2 SV=1
10	AFDB:Q5PP28	0.219	0.094	3.584	394	0.070	0.028	Q5PP28.pdb.gz	NAC3_ARATH NAC domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=NAC003 PE=2 SV=1
11	PDB:5apnb	0.129	0.333	5.570	58	0.051	0.138	5apnb.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
12	PDB:7ajtCL	0.152	0.038	5.570	781	0.120	0.024	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:4v6wCC	0.121	0.058	6.387	392	0.089	0.036	4v6wCC.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	PDB:7d63RJ	0.231	0.053	7.324	796	0.095	0.019	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
15	PDB:6yxyBE	0.091	0.048	7.843	407	0.051	0.020	6yxyBE.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
16	PDB:4rfpA	0.099	0.123	9.631	121	0.019	0.025	4rfpA.pdb.gz
17	PDB:6ff4C	0.221	0.135	9.631	286	0.158	0.087	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:7dvqR	0.135	0.103	9.631	241	0.120	0.079	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:7knuE	0.141	0.191	9.631	115	0.063	0.087	7knuE.pdb.gz	Structure and dynamics of the CGRP receptor in apo and peptide-bound forms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26717	5.80e-86	253	231	0.791	0.541	NKG2C_HUMAN NKG2-C type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC2 PE=1 SV=3
2	Q07444	1.81e-83	247	240	0.797	0.525	NKG2E_HUMAN NKG2-E type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC3 PE=2 SV=3
3	P26715	8.80e-64	197	233	0.614	0.416	NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC1 PE=1 SV=2
4	Q9Z202	9.85e-29	107	244	0.386	0.250	Q9Z202_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
5	Q9WU32	2.79e-28	106	227	0.342	0.238	Q9WU32_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
6	Q9WU31	3.19e-28	106	244	0.386	0.250	Q9WU31_MOUSE Natural killer cell receptor NKG2A OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
7	A6H5Z4	1.45e-27	104	244	0.380	0.246	A6H5Z4_MOUSE Klrc1 protein OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
8	Q8CB89	7.26e-20	84.0	206	0.272	0.209	Q8CB89_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
9	D3YXP2	1.16e-19	83.6	221	0.278	0.199	D3YXP2_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=4 SV=1
10	Q9WTJ9	2.36e-19	83.2	238	0.291	0.193	Q9WTJ9_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
11	Q9QXN7	1.30e-17	78.2	221	0.278	0.199	Q9QXN7_MOUSE Killer cell lectin-like receptor subfamily C, member 3 OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
12	A1L3Q6	2.13e-17	78.2	246	0.291	0.187	A1L3Q6_MOUSE Klrc3 protein OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
13	Q9WVJ7	5.69e-17	76.3	213	0.259	0.192	Q9WVJ7_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
14	Q9WVJ8	2.72e-16	74.7	210	0.259	0.195	Q9WVJ8_MOUSE Natural killer cell protein group 2-A2 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
15	E9QAJ6	3.08e-16	74.3	210	0.259	0.195	E9QAJ6_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=4 SV=1
16	L7N477	4.91e-15	71.2	213	0.266	0.197	L7N477_MOUSE Killer cell lectin-like receptor subfamily C, member 3 OS=Mus musculus OX=10090 GN=Klrc3 PE=4 SV=1
17	Q13241	5.08e-08	52.0	179	0.177	0.156	KLRD1_HUMAN Natural killer cells antigen CD94 OS=Homo sapiens OX=9606 GN=KLRD1 PE=1 SV=2
18	Q80ZC8	1.81e-07	50.8	226	0.184	0.128	KLRE1_RAT Killer cell lectin-like receptor subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Klre1 PE=1 SV=1
19	Q8CJC7	2.85e-07	50.4	226	0.215	0.150	KLRE1_MOUSE Killer cell lectin-like receptor subfamily E member 1 OS=Mus musculus OX=10090 GN=Klre1 PE=1 SV=1
20	A0A0N4SV83	4.65e-05	42.0	90	0.139	0.244	A0A0N4SV83_MOUSE Killer cell lectin-like receptor subfamily C, member 3 OS=Mus musculus OX=10090 GN=Klrc3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05473 UL45	3.9	18.6	UL45 protein, carbohydrate-binding C-type lectin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310216

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371333	0.928	Natural killer cells antigen CD94
2	9606.ENSP00000452780	0.928	Beta-2-microglobulin
3	9606.ENSP00000379873	0.926	HLA class I histocompatibility antigen, A-3 alpha chain
4	9606.ENSP00000371327	0.925	NKG2-C type II integral membrane protein
5	9606.ENSP00000438038	0.912	NKG2-A/NKG2-B type II integral membrane protein
6	9606.ENSP00000391592	0.906	Tyrosine-protein phosphatase non-receptor type 6
7	9606.ENSP00000375608	0.871	Killer cell immunoglobulin-like receptor 3DL1
8	9606.ENSP00000342215	0.870	Killer cell immunoglobulin-like receptor 2DL3
9	9606.ENSP00000336769	0.859	Killer cell immunoglobulin-like receptor 2DL1
10	9606.ENSP00000325525	0.848	Killer cell immunoglobulin-like receptor 3DL2
11	9606.ENSP00000291860	0.824	Killer cell immunoglobulin-like receptor 3DL3
12	9606.ENSP00000480609	0.816	annotation not available
13	9606.ENSP00000437563	0.804	Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells
14	9606.ENSP00000240618	0.792	Killer cell lectin-like receptor subfamily K, member 1
15	9606.ENSP00000365817	0.789	HLA class I histocompatibility antigen, alpha chain E
16	9606.ENSP00000399168	0.762	HLA class I histocompatibility antigen, B-7 alpha chain
17	9606.ENSP00000262629	0.712	TYRO protein tyrosine kinase-binding protein
18	9606.ENSP00000365402	0.703	HLA class I histocompatibility antigen, Cw-7 alpha chain
19	9606.ENSP00000412927	0.676	HLA class I histocompatibility antigen, alpha chain G
20	9606.ENSP00000259951	0.669	HLA class I histocompatibility antigen, alpha chain F

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	0.998	transmembrane signaling receptor activity
GO:0140375	0.330	immune receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0050896	0.973	response to stimulus
GO:0048583	0.930	regulation of response to stimulus
GO:0002682	0.871	regulation of immune system process
GO:0051716	0.855	cellular response to stimulus
GO:0023052	0.755	signaling
GO:0050776	0.748	regulation of immune response
GO:0007154	0.742	cell communication
GO:0002703	0.703	regulation of leukocyte mediated immunity
GO:0048519	0.691	negative regulation of biological process
GO:0007165	0.655	signal transduction
GO:0032101	0.650	regulation of response to external stimulus
GO:0031347	0.633	regulation of defense response
GO:0002831	0.628	regulation of response to biotic stimulus
GO:0045088	0.614	regulation of innate immune response
GO:0002706	0.591	regulation of lymphocyte mediated immunity
GO:0048518	0.581	positive regulation of biological process
GO:0031341	0.550	regulation of cell killing
GO:0002376	0.546	immune system process
GO:0002715	0.535	regulation of natural killer cell mediated immunity
GO:0001910	0.527	regulation of leukocyte mediated cytotoxicity
GO:0048523	0.490	negative regulation of cellular process
GO:0006950	0.488	response to stress
GO:0006952	0.443	defense response
GO:0042269	0.443	regulation of natural killer cell mediated cytotoxicity
GO:0002684	0.410	positive regulation of immune system process
GO:0007166	0.357	cell surface receptor signaling pathway
GO:0048584	0.347	positive regulation of response to stimulus
GO:0050778	0.341	positive regulation of immune response
GO:0002699	0.325	positive regulation of immune effector process
GO:0051239	0.322	regulation of multicellular organismal process
GO:0048522	0.322	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0009986	0.900	cell surface
GO:0032991	0.885	protein-containing complex
GO:0043226	0.779	organelle
GO:0043229	0.758	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]