StarFunc result for job id O43909

User Input

>input (919 residues)
MTGYTMLRNGGAGNGGQTCMLRWSNRIRLTWLSFTLFVILVFFPLIAHYYLTTLDEADEA
GKRIFGPRVGNELCEVKHVLDLCRIRESVSEELLQLEAKRQELNSEIAKLNLKIEACKKS
IENAKQDLLQLKNVISQTEHSYKELMAQNQPKLSLPIRLLPEKDDAGLPPPKATRGCRLH
NCFDYSRCPLTSGFPVYVYDSDQFVFGSYLDPLVKQAFQATARANVYVTENADIACLYVI
LVGEMQEPVVLRPAELEKQLYSLPHWRTDGHNHVIINLSRKSDTQNLLYNVSTGRAMVAQ
STFYTVQYRPGFDLVVSPLVHAMSEPNFMEIPPQVPVKRKYLFTFQGEKIESLRSSLQEA
RSFEEEMEGDPPADYDDRIIATLKAVQDSKLDQVLVEFTCKNQPKPSLPTEWALCGERED
RLELLKLSTFALIITPGDPRLVISSGCATRLFEALEVGAVPVVLGEQVQLPYQDMLQWNE
AALVVPKPRVTEVHFLLRSLSDSDLLAMRRQGRFLWETYFSTADSIFNTVLAMIRTRIQI
PAAPIREEAAAEIPHRSGKAAGTDPNMADNGDLDLGPVETEPPYASPRYLRNFTLTVTDF
YRSWNCAPGPFHLFPHTPFDPVLPSEAKFLGSGTGFRPIGGGAGGSGKEFQAALGGNVPR
EQFTVVMLTYEREEVLMNSLERLNGLPYLNKVVVVWNSPKLPSEDLLWPDIGVPIMVVRT
EKNSLNNRFLPWNEIETEAILSIDDDAHLRHDEIMFGFRVWREARDRIVGFPGRYHAWDI
PHQSWLYNSNYSCELSMVLTGAAFFHKYYAYLYSYVMPQAIRDMVDEYINCEDIAMNFLV
SHITRKPPIKVTSRWTFRCPGCPQALSHDDSHFHERHKCINFFVKVYGYMPLLYTQFRVD
SVLFKTRLPHDKTKCFKFI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7au2A	0.742	0.992	0.000	686	0.746	1.000	7au2A.pdb.gz
2	AFDB:O43909	1.000	1.000	0.000	919	1.000	1.000	O43909.pdb.gz	EXTL3_HUMAN Exostosin-like 3 OS=Homo sapiens OX=9606 GN=EXTL3 PE=1 SV=1
3	AFDB:Q5U7D2	0.877	0.878	0.000	917	0.829	0.831	Q5U7D2.pdb.gz	Q5U7D2_DANRE Exostoses (Multiple)-like 3 OS=Danio rerio OX=7955 GN=im:7141548 PE=1 SV=1
4	AFDB:Q9XZ08	0.802	0.759	0.000	972	0.499	0.472	Q9XZ08.pdb.gz	EXT3_DROME Exostosin-3 OS=Drosophila melanogaster OX=7227 GN=botv PE=1 SV=1
5	AFDB:O01705	0.691	0.777	1.912E-72	814	0.324	0.366	O01705.pdb.gz	EXT2_CAEEL Exostosin-2 homolog OS=Caenorhabditis elegans OX=6239 GN=rib-2 PE=1 SV=2
6	AFDB:F1QUC2	0.304	0.381	1.552E-55	719	0.269	0.344	F1QUC2.pdb.gz
7	AFDB:O77783	0.324	0.386	1.751E-54	718	0.273	0.350	O77783.pdb.gz	EXT2_BOVIN Exostosin-2 OS=Bos taurus OX=9913 GN=EXT2 PE=1 SV=1
8	AFDB:G3V901	0.433	0.510	9.491E-54	746	0.246	0.303	G3V901.pdb.gz	G3V901_RAT Exostosin glycosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ext1 PE=3 SV=1
9	AFDB:Q9Y169	0.314	0.394	1.070E-52	717	0.248	0.318	Q9Y169.pdb.gz	EXT2_DROME Exostosin-2 OS=Drosophila melanogaster OX=7227 GN=sotv PE=1 SV=1
10	PDB:7sckA	0.408	0.540	1.037E-50	642	0.229	0.327	7sckA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
11	AFDB:Q9V730	0.437	0.507	7.810E-50	760	0.214	0.259	Q9V730.pdb.gz	EXT1_DROME Exostosin-1 OS=Drosophila melanogaster OX=7227 GN=ttv PE=1 SV=1
12	PDB:7sckB	0.392	0.540	8.406E-49	598	0.247	0.380	7sckB.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
13	PDB:7schA	0.401	0.563	1.879E-46	603	0.220	0.335	7schA.pdb.gz
14	AFDB:Q92935	0.391	0.499	4.466E-42	676	0.205	0.278	Q92935.pdb.gz	EXTL1_HUMAN Exostosin-like 1 OS=Homo sapiens OX=9606 GN=EXTL1 PE=1 SV=2
15	PDB:7scjA	0.378	0.573	1.315E-41	563	0.212	0.346	7scjA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
16	PDB:2iv7A	0.175	0.342	5.048E-5	370	0.058	0.143	2iv7A.pdb.gz	Insights Into the Synthesis of Lipopolysaccharide and Antibiotics Through the Structures of Two Retaining Glycosyltransferases from Family Gt4
17	PDB:5f84A	0.185	0.406	5.650E-5	365	0.049	0.123	5f84A.pdb.gz	Structural analysis of Notch-regulating Rumi reveals basis for pathogenic mutations.
18	PDB:4d11C	0.136	0.271	4.295E-4	436	0.026	0.055	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
19	PDB:4d0tA	0.152	0.268	4.808E-4	496	0.034	0.062	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
20	PDB:4fixA	0.139	0.197	6.023E-4	629	0.032	0.046	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K6F4	0.0	1628	845	0.851	0.925	A0A0G2K6F4_RAT Exostosin-like glycosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Extl3 PE=3 SV=1
2	O43909	0.0	1915	919	1.000	1.000	EXTL3_HUMAN Exostosin-like 3 OS=Homo sapiens OX=9606 GN=EXTL3 PE=1 SV=1
3	Q5U7D2	0.0	1578	917	0.828	0.830	Q5U7D2_DANRE Exostoses (Multiple)-like 3 OS=Danio rerio OX=7955 GN=im:7141548 PE=1 SV=1
4	Q9JMA8	0.0	1872	919	0.973	0.973	Q9JMA8_RAT Exostosin-like glycosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Extl3 PE=3 SV=1
5	Q9WVL6	0.0	1862	918	0.972	0.973	EXTL3_MOUSE Exostosin-like 3 OS=Mus musculus OX=10090 GN=Extl3 PE=1 SV=2
6	Q9XZ08	0.0	840	972	0.495	0.468	EXT3_DROME Exostosin-3 OS=Drosophila melanogaster OX=7227 GN=botv PE=1 SV=1
7	O01705	8.15e-142	443	814	0.252	0.285	EXT2_CAEEL Exostosin-2 homolog OS=Caenorhabditis elegans OX=6239 GN=rib-2 PE=1 SV=2
8	Q5U7A7	3.46e-79	274	719	0.150	0.192	Q5U7A7_DANRE Exostosin-2 OS=Danio rerio OX=7955 GN=fc14g07 PE=1 SV=1
9	O77783	1.20e-78	272	718	0.151	0.194	EXT2_BOVIN Exostosin-2 OS=Bos taurus OX=9913 GN=EXT2 PE=1 SV=1
10	Q93063	1.79e-78	272	718	0.150	0.192	EXT2_HUMAN Exostosin-2 OS=Homo sapiens OX=9606 GN=EXT2 PE=1 SV=1
11	P70428	4.79e-78	271	718	0.149	0.191	EXT2_MOUSE Exostosin-2 OS=Mus musculus OX=10090 GN=Ext2 PE=1 SV=2
12	Q9V730	1.06e-77	271	760	0.240	0.291	EXT1_DROME Exostosin-1 OS=Drosophila melanogaster OX=7227 GN=ttv PE=1 SV=1
13	Q9Y169	1.71e-72	255	717	0.144	0.184	EXT2_DROME Exostosin-2 OS=Drosophila melanogaster OX=7227 GN=sotv PE=1 SV=1
14	Q3B8R0	4.00e-49	185	557	0.109	0.180	Q3B8R0_RAT Ext1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ext1 PE=2 SV=1
15	G3V901	6.36e-48	185	746	0.109	0.134	G3V901_RAT Exostosin glycosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ext1 PE=3 SV=1
16	P97464	6.36e-48	185	746	0.109	0.134	EXT1_MOUSE Exostosin-1 OS=Mus musculus OX=10090 GN=Ext1 PE=1 SV=1
17	Q16394	7.72e-48	185	746	0.109	0.134	EXT1_HUMAN Exostosin-1 OS=Homo sapiens OX=9606 GN=EXT1 PE=1 SV=2
18	Q92935	1.21e-39	159	676	0.095	0.129	EXTL1_HUMAN Exostosin-like 1 OS=Homo sapiens OX=9606 GN=EXTL1 PE=1 SV=2
19	Q9ES89	5.98e-36	141	330	0.092	0.258	EXTL2_MOUSE Exostosin-like 2 OS=Mus musculus OX=10090 GN=Extl2 PE=1 SV=1
20	Q9UBQ6	5.39e-35	138	330	0.092	0.258	EXTL2_HUMAN Exostosin-like 2 OS=Homo sapiens OX=9606 GN=EXTL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	86	14.7	Afadin- and alpha -actinin-Binding
2	PF07889 DUF1664	80	14.7	Protein of unknown function (DUF1664)
3	PF03016 Exostosin	1.5e-58	210.0	Exostosin family
4	PF09258 Glyco_transf_64	1.1e-98	341.0	Glycosyl transferase family 64 domain
5	PF12795 MscS_porin	1.5e+02	13.4	Mechanosensitive ion channel porin domain
6	PF02403 Seryl_tRNA_N	1.7e+02	13.8	Seryl-tRNA synthetase N-terminal domain
7	PF18394 TBK1_CCD1	6.7e+02	11.2	TANK-binding kinase 1 coiled-coil domain 1
8	PF05615 THOC7	87	14.8	Tho complex subunit 7
9	PF07926 TPR_MLP1_2	19	16.7	TPR/MLP1/MLP2-like protein
10	PF12718 Tropomyosin_1	4.5e+02	12.4	Tropomyosin like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220562

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216037	0.900	X-box-binding protein 1
2	9606.ENSP00000363398	0.890	Exostosin-like 1
3	9606.ENSP00000359132	0.870	Exostosin-like 2
4	9606.ENSP00000283148	0.800	UDP-glucuronic acid decarboxylase 1
5	9606.ENSP00000377401	0.779	Adenosine 3'-phospho 5'-phosphosulfate transporter 1
6	9606.ENSP00000261797	0.778	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
7	9606.ENSP00000427888	0.769	Heparan sulfate glucosamine 3-O-sulfotransferase 5
8	9606.ENSP00000359581	0.767	Heparan sulfate 2-O-sulfotransferase 1
9	9606.ENSP00000261858	0.750	D-glucuronyl C5-epimerase
10	9606.ENSP00000246957	0.732	Heat shock protein 75 kDa, mitochondrial
11	9606.ENSP00000261381	0.713	Xylosyltransferase 1
12	9606.ENSP00000359579	0.707	Heparan sulfate 2-O-sulfotransferase 1
13	9606.ENSP00000296499	0.697	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3
14	9606.ENSP00000254190	0.684	Chondroitin sulfate synthase 1
15	9606.ENSP00000002596	0.679	Heparan sulfate glucosamine 3-O-sulfotransferase 1
16	9606.ENSP00000259241	0.678	Heparan-sulfate 6-O-sulfotransferase 1
17	9606.ENSP00000029410	0.677	Beta-1,4-galactosyltransferase 7
18	9606.ENSP00000017003	0.667	Xylosyltransferase 2
19	9606.ENSP00000265471	0.655	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3
20	9606.ENSP00000377456	0.645	Regenerating islet-derived protein 3-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0046872	0.999	metal ion binding
GO:0000287	0.994	magnesium ion binding
GO:0001888	0.935	glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase activity
GO:0042802	0.579	identical protein binding
GO:0015020	0.393	glucuronosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:1901576	0.980	organic substance biosynthetic process
GO:0044249	0.980	cellular biosynthetic process
GO:0019538	0.980	protein metabolic process
GO:1901135	0.979	carbohydrate derivative metabolic process
GO:1901137	0.974	carbohydrate derivative biosynthetic process
GO:0044260	0.973	cellular macromolecule metabolic process
GO:1901566	0.960	organonitrogen compound biosynthetic process
GO:0015012	0.945	heparan sulfate proteoglycan biosynthetic process
GO:0065007	0.878	biological regulation
GO:0050789	0.793	regulation of biological process
GO:0050794	0.690	regulation of cellular process
GO:0048518	0.409	positive regulation of biological process
GO:0040008	0.360	regulation of growth
GO:0051128	0.328	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	0.999	endomembrane system
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0005737	0.993	cytoplasm
GO:0005794	0.976	Golgi apparatus
GO:0031090	0.936	organelle membrane
GO:0098588	0.876	bounding membrane of organelle
GO:0005783	0.746	endoplasmic reticulum
GO:0042175	0.546	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.537	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:16221	0.935	3-O-(beta-D-GlcA-(1->3)-beta-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-Xyl)-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(alpha-D-GlcNAc-(1->4)-beta-D-GlcA-(1->3)-beta-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-Xyl)-L-seryl-[protein] + H(+) + UDP
EC:2.4.1.223	0.935	acetylglucosaminyltransferase.
RHEA:21032	0.393	glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP
EC:2.4.1.17	0.393	glucuronosyltransferase.

[back to server]