StarFunc result for job id O43913

User Input

>input (435 residues)
MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVF
VNCVECFTLRLLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTV
YIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFP
DYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPV
VKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHV
ELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLD
RLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIA
RTVNFDIIKYLYDFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4D0P7	0.985	0.985	2.116E-77	435	1.000	1.000	A4D0P7.pdb.gz	A4D0P7_HUMAN Origin recognition complex, subunit 5-like (Yeast) OS=Homo sapiens OX=9606 GN=ORC5L PE=1 SV=1
2	PDB:7jppE	0.880	0.941	2.016E-63	406	0.933	1.000	7jppE.pdb.gz	The dynamic nature of the human Origin Recognition Complex revealed through five cryoEM structures.
3	PDB:7jpsE	0.839	0.942	6.204E-58	386	0.887	1.000	7jpsE.pdb.gz	The dynamic nature of the human Origin Recognition Complex revealed through five cryoEM structures.
4	PDB:5ujmE	0.773	0.934	1.488E-50	357	0.818	0.997	5ujmE.pdb.gz	Structure of the active form of human Origin Recognition Complex and its ATPase motor module.
5	AFDB:Q24169	0.911	0.863	3.066E-39	460	0.375	0.354	Q24169.pdb.gz	ORC5_DROME Origin recognition complex subunit 5 OS=Drosophila melanogaster OX=7227 GN=Orc5 PE=1 SV=1
6	PDB:4xgcE	0.800	0.864	1.165E-31	402	0.345	0.373	4xgcE.pdb.gz	Crystal structure of the eukaryotic origin recognition complex.
7	AFDB:Q6EWX0	0.816	0.672	1.368E-28	534	0.280	0.228	Q6EWX0.pdb.gz	ORC5_ARATH Origin of replication complex subunit 5 OS=Arabidopsis thaliana OX=3702 GN=ORC5 PE=1 SV=1
8	AFDB:O43114	0.785	0.752	1.539E-27	455	0.262	0.251	O43114.pdb.gz	ORC5_SCHPO Origin recognition complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc5 PE=1 SV=2
9	AFDB:Q10CI8	0.812	0.681	3.447E-27	524	0.267	0.221	Q10CI8.pdb.gz	ORC5_ORYSJ Origin of replication complex subunit 1 OS=Oryza sativa subsp. japonica OX=39947 GN=ORC5 PE=2 SV=1
10	AFDB:P50874	0.545	0.502	1.006E-21	479	0.216	0.196	P50874.pdb.gz	ORC5_YEAST Origin recognition complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORC5 PE=1 SV=1
11	PDB:7tjhE	0.752	0.746	9.396E-21	439	0.225	0.223	7tjhE.pdb.gz	A mechanism of origin licensing control through autoinhibition of S. cerevisiae ORC·DNA·Cdc6.
12	AFDB:O96237	0.791	0.403	3.141E-20	899	0.223	0.108	O96237.pdb.gz	ORC5_PLAF7 Origin recognition complex subunit 5 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=ORC5 PE=1 SV=1
13	PDB:5zr1E	0.751	0.713	6.512E-20	460	0.211	0.200	5zr1E.pdb.gz	Structure of the origin recognition complex bound to DNA replication origin.
14	PDB:5v8fE	0.691	0.710	1.748E-17	422	0.221	0.227	5v8fE.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
15	AFDB:Q9UXF8	0.421	0.440	7.535E-13	413	0.143	0.150	Q9UXF8.pdb.gz	CDC62_SACS2 ORC1-type DNA replication protein 2 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=cdc6-2 PE=1 SV=1
16	AFDB:Q980N4	0.432	0.466	7.951E-13	397	0.147	0.161	Q980N4.pdb.gz	CDC61_SACS2 ORC1-type DNA replication protein 1 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=cdc6-1 PE=1 SV=1
17	AFDB:O43929	0.523	0.522	4.444E-12	436	0.138	0.138	O43929.pdb.gz	ORC4_HUMAN Origin recognition complex subunit 4 OS=Homo sapiens OX=9606 GN=ORC4 PE=1 SV=2
18	PDB:2qbyA	0.424	0.486	6.323E-12	366	0.149	0.178	2qbyA.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
19	PDB:7jgrD	0.508	0.502	2.064E-11	441	0.117	0.116	7jgrD.pdb.gz	Structural mechanism for replication origin binding and remodeling by a metazoan origin recognition complex and its co-loader Cdc6.
20	PDB:2qbyB	0.425	0.489	8.355E-11	368	0.138	0.163	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4D0P7	0.0	898	435	1.000	1.000	A4D0P7_HUMAN Origin recognition complex, subunit 5-like (Yeast) OS=Homo sapiens OX=9606 GN=ORC5L PE=1 SV=1
2	O43913	0.0	898	435	1.000	1.000	ORC5_HUMAN Origin recognition complex subunit 5 OS=Homo sapiens OX=9606 GN=ORC5 PE=1 SV=1
3	Q9WUV0	0.0	855	435	0.938	0.938	ORC5_MOUSE Origin recognition complex subunit 5 OS=Mus musculus OX=10090 GN=Orc5 PE=2 SV=1
4	Q24169	1.34e-87	276	460	0.384	0.363	ORC5_DROME Origin recognition complex subunit 5 OS=Drosophila melanogaster OX=7227 GN=Orc5 PE=1 SV=1
5	Q6EWX0	1.80e-38	147	534	0.301	0.245	ORC5_ARATH Origin of replication complex subunit 5 OS=Arabidopsis thaliana OX=3702 GN=ORC5 PE=1 SV=1
6	O43114	5.51e-31	125	455	0.280	0.268	ORC5_SCHPO Origin recognition complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc5 PE=1 SV=2
7	Q10CI8	1.57e-28	119	524	0.230	0.191	ORC5_ORYSJ Origin of replication complex subunit 1 OS=Oryza sativa subsp. japonica OX=39947 GN=ORC5 PE=2 SV=1
8	P50874	4.15e-13	73.2	479	0.257	0.234	ORC5_YEAST Origin recognition complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORC5 PE=1 SV=1
9	O96237	2.61e-06	52.4	899	0.133	0.065	ORC5_PLAF7 Origin recognition complex subunit 5 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=ORC5 PE=1 SV=1
10	P91155	0.11	37.4	518	0.108	0.091	P91155_CAEEL Cell division control protein OS=Caenorhabditis elegans OX=6239 GN=cdc-6 PE=1 SV=1
11	O74427	0.15	37.0	454	0.044	0.042	URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=urk1 PE=3 SV=1
12	Q980N4	0.18	36.6	397	0.060	0.065	CDC61_SACS2 ORC1-type DNA replication protein 1 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=cdc6-1 PE=1 SV=1
13	Q9JHS4	0.89	34.3	634	0.032	0.022	CLPX_MOUSE ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Mus musculus OX=10090 GN=Clpx PE=1 SV=2
14	O76031	0.95	34.3	633	0.032	0.022	CLPX_HUMAN ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens OX=9606 GN=CLPX PE=1 SV=2
15	A0A0B4LID7	0.99	34.3	679	0.030	0.019	A0A0B4LID7_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=ClpX PE=1 SV=1
16	P32266	1.3	33.9	881	0.074	0.036	MGM1_YEAST Dynamin-like GTPase MGM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MGM1 PE=1 SV=3
17	Q66HW5	1.3	33.9	610	0.032	0.023	Q66HW5_DANRE ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Danio rerio OX=7955 GN=zgc:92303 PE=1 SV=1
18	P9WPB9	1.8	33.1	426	0.041	0.042	CLPX_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=clpX PE=1 SV=1
19	Q92376	3.2	32.7	832	0.032	0.017	KLP1_SCHPO Kinesin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=klp1 PE=2 SV=2
20	Q8S950	6.1	32.0	959	0.108	0.049	KN7A_TOBAC Kinesin-like protein NACK1 OS=Nicotiana tabacum OX=4097 GN=NACK1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	3.5e-11	55.2	AAA ATPase domain
2	PF13401 AAA_22	0.00039	32.2	AAA domain
3	PF00225 Kinesin	3.1e+02	11.7	Kinesin motor domain
4	PF14630 ORC5_C	1e-63	227.1	Origin recognition complex (ORC) subunit 5 C-terminus
5	PF05970 PIF1	5e+02	11.1	PIF1-like helicase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297431

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000209728	0.999	Cell division control protein 6 homolog
2	9606.ENSP00000216122	0.999	DNA replication licensing factor MCM5
3	9606.ENSP00000219097	0.999	Origin recognition complex subunit 6
4	9606.ENSP00000234296	0.999	Origin recognition complex subunit 2
5	9606.ENSP00000257789	0.999	Origin recognition complex subunit 3
6	9606.ENSP00000262105	0.999	DNA replication licensing factor MCM4
7	9606.ENSP00000265056	0.999	DNA replication licensing factor MCM2
8	9606.ENSP00000307288	0.999	DNA replication licensing factor MCM7
9	9606.ENSP00000360623	0.999	Origin recognition complex subunit 1
10	9606.ENSP00000441953	0.999	Origin recognition complex subunit 4
11	9606.ENSP00000480987	0.999	DNA replication licensing factor MCM3
12	9606.ENSP00000292616	0.996	Leucine-rich repeat and WD repeat-containing protein 1
13	9606.ENSP00000264156	0.995	DNA replication licensing factor MCM6
14	9606.ENSP00000484105	0.989	DNA primase large subunit
15	9606.ENSP00000405726	0.987	Cell division control protein 45 homolog
16	9606.ENSP00000301019	0.986	DNA replication factor Cdt1
17	9606.ENSP00000265465	0.985	DNA polymerase alpha subunit B
18	9606.ENSP00000368349	0.978	DNA polymerase alpha catalytic subunit
19	9606.ENSP00000393139	0.976	Cell division cycle 7-related protein kinase
20	9606.ENSP00000350491	0.971	DNA primase small subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.990	heterocyclic compound binding
GO:0097159	0.990	organic cyclic compound binding
GO:0003676	0.979	nucleic acid binding
GO:0003677	0.959	DNA binding
GO:0003688	0.932	DNA replication origin binding
GO:1901265	0.906	nucleoside phosphate binding
GO:0000166	0.902	nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0006259	0.986	DNA metabolic process
GO:0006260	0.983	DNA replication
GO:0051052	0.935	regulation of DNA metabolic process
GO:0006261	0.829	DNA-templated DNA replication
GO:0006275	0.672	regulation of DNA replication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0005694	0.998	chromosome
GO:0098687	0.923	chromosomal region
GO:0140513	0.909	nuclear protein-containing complex
GO:0000228	0.879	nuclear chromosome
GO:0000781	0.803	chromosome, telomeric region
GO:0000785	0.761	chromatin
GO:0000808	0.748	origin recognition complex
GO:0005664	0.374	nuclear origin of replication recognition complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]