StarFunc result for job id O43914

User Input

>input (113 residues)
MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALA
VYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43914	1.000	1.000	3.306E-19	113	1.000	1.000	O43914.pdb.gz	TYOBP_HUMAN TYRO protein tyrosine kinase-binding protein OS=Homo sapiens OX=9606 GN=TYROBP PE=1 SV=1
2	AFDB:O54885	0.410	0.407	7.708E-10	114	0.743	0.737	O54885.pdb.gz	TYOBP_MOUSE TYRO protein tyrosine kinase-binding protein OS=Mus musculus OX=10090 GN=Tyrobp PE=1 SV=1
3	AFDB:P01257	0.285	0.241	3.241E-1	136	0.239	0.199	P01257.pdb.gz	CALC_RAT Calcitonin OS=Rattus norvegicus OX=10116 GN=Calca PE=1 SV=1
4	AFDB:P47939	0.294	0.220	8.250E-1	175	0.177	0.114	P47939.pdb.gz	RES18_MOUSE Regulated endocrine-specific protein 18 OS=Mus musculus OX=10090 GN=Resp18 PE=2 SV=1
5	AFDB:M0R576	0.234	0.195	8.919E-1	137	0.177	0.146	M0R576.pdb.gz	M0R576_RAT T-cell surface glycoprotein CD3 zeta chain OS=Rattus norvegicus OX=10116 GN=Cd247 PE=1 SV=2
6	AFDB:E7F404	0.247	0.220	1.316	134	0.159	0.134	E7F404.pdb.gz	E7F404_DANRE Osteocrin OS=Danio rerio OX=7955 GN=ostn PE=4 SV=1
7	AFDB:Q2F908	0.172	0.066	1.538	435	0.159	0.041	Q2F908.pdb.gz	Q2F908_ORYSJ Cytochrome c biogenesis Fc OS=Oryza sativa subsp. japonica OX=39947 GN=ccmFc PE=4 SV=1
8	AFDB:Q38AS2	0.234	0.098	2.454	320	0.195	0.069	Q38AS2.pdb.gz	Q38AS2_TRYB2 Mitochondrial ribosomal protein S18 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3900 PE=1 SV=1
9	AFDB:A0A0G2K184	0.250	0.145	2.653	257	0.150	0.066	A0A0G2K184.pdb.gz	A0A0G2K184_RAT Lysosomal protein transmembrane 5 OS=Rattus norvegicus OX=10116 GN=Laptm5 PE=3 SV=1
10	AFDB:P01258	0.309	0.254	2.653	141	0.221	0.177	P01258.pdb.gz	CALC_HUMAN Calcitonin OS=Homo sapiens OX=9606 GN=CALCA PE=1 SV=3
11	PDB:7tyxE	0.157	0.158	7.720	112	0.088	0.089	7tyxE.pdb.gz	A structural basis for amylin receptor phenotype.
12	PDB:7qooK	0.212	0.116	9.021	253	0.115	0.051	7qooK.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
13	PDB:2aczC	0.224	0.201	9.751	129	0.088	0.078	2aczC.pdb.gz	Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
14	PDB:3j6b2	0.175	0.175	9.751	113	0.088	0.088	3j6b2.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
15	PDB:6zr2h	0.192	0.174	9.751	138	0.142	0.116	6zr2h.pdb.gz	Structure of inhibitor-bound mammalian complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43914	2.98e-77	224	113	1.000	1.000	TYOBP_HUMAN TYRO protein tyrosine kinase-binding protein OS=Homo sapiens OX=9606 GN=TYROBP PE=1 SV=1
2	X6RGC9	2.25e-63	189	101	0.894	1.000	X6RGC9_HUMAN TYRO protein tyrosine kinase-binding protein OS=Homo sapiens OX=9606 GN=TYROBP PE=1 SV=1
3	O54885	1.83e-50	157	114	0.743	0.737	TYOBP_MOUSE TYRO protein tyrosine kinase-binding protein OS=Mus musculus OX=10090 GN=Tyrobp PE=1 SV=1
4	Q6X9T7	1.08e-48	152	114	0.717	0.711	TYOBP_RAT TYRO protein tyrosine kinase-binding protein OS=Rattus norvegicus OX=10116 GN=Tyrobp PE=3 SV=1
5	F1QN44	9.30e-15	66.6	115	0.354	0.348	F1QN44_DANRE TYRO protein tyrosine kinase-binding protein OS=Danio rerio OX=7955 GN=dap12 PE=3 SV=1
6	P04235	3.70e-06	45.4	173	0.274	0.179	CD3D_MOUSE T-cell surface glycoprotein CD3 delta chain OS=Mus musculus OX=10090 GN=Cd3d PE=1 SV=1
7	B5LZ55	2.38e-05	42.4	116	0.301	0.293	B5LZ55_ICTPU TYRO protein tyrosine kinase-binding protein OS=Ictalurus punctatus OX=7998 GN=tyrobp PE=2 SV=1
8	Q90768	1.69e-04	40.8	175	0.239	0.154	Q90768_CHICK CD3 glycoprotein OS=Gallus gallus OX=9031 GN=CD3D PE=1 SV=1
9	Q6PW00	1.73e-04	40.8	175	0.239	0.154	Q6PW00_CHICK CD3 glycoprotein OS=Gallus gallus OX=9031 PE=2 SV=1
10	P04234	3.23e-04	40.0	171	0.221	0.146	CD3D_HUMAN T-cell surface glycoprotein CD3 delta chain OS=Homo sapiens OX=9606 GN=CD3D PE=1 SV=1
11	P11942	0.024	35.0	182	0.177	0.110	CD3G_MOUSE T-cell surface glycoprotein CD3 gamma chain OS=Mus musculus OX=10090 GN=Cd3g PE=1 SV=1
12	B0YIY5	0.23	32.3	182	0.177	0.110	B0YIY5_HUMAN T-cell surface glycoprotein CD3 gamma chain OS=Homo sapiens OX=9606 GN=CD3G PE=2 SV=1
13	P09693	0.23	32.3	182	0.177	0.110	CD3G_HUMAN T-cell surface glycoprotein CD3 gamma chain OS=Homo sapiens OX=9606 GN=CD3G PE=1 SV=1
14	Q9QUJ0	0.27	30.8	79	0.186	0.266	HCST_MOUSE Hematopoietic cell signal transducer OS=Mus musculus OX=10090 GN=Hcst PE=1 SV=1
15	Q6R2J8	0.32	32.0	703	0.212	0.034	SRF8_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Arabidopsis thaliana OX=3702 GN=SRF8 PE=1 SV=1
16	Q92952	1.3	30.4	543	0.177	0.037	KCNN1_HUMAN Small conductance calcium-activated potassium channel protein 1 OS=Homo sapiens OX=9606 GN=KCNN1 PE=1 SV=2
17	P70069	1.9	29.6	175	0.177	0.114	P70069_CHICK CD3 epsilon protein OS=Gallus gallus OX=9031 GN=CD3 epsilon PE=1 SV=1
18	B3VMQ8	2.1	29.3	175	0.177	0.114	B3VMQ8_CHICK CD3 epsilon chain OS=Gallus gallus OX=9031 GN=CD3e PE=2 SV=1
19	P13688	2.4	29.6	526	0.115	0.025	CEAM1_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CEACAM1 PE=1 SV=2
20	Q9D2Z1	2.4	29.6	577	0.159	0.031	CEA20_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 20 OS=Mus musculus OX=10090 GN=Ceacam20 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07213 DAP10	2.7	19.3	DAP10 membrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262629

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362205	0.999	Triggering receptor expressed on myeloid cells 2
2	9606.ENSP00000364907	0.999	Tyrosine-protein kinase SYK
3	9606.ENSP00000244709	0.998	Triggering receptor expressed on myeloid cells 1
4	9606.ENSP00000362181	0.998	Natural cytotoxicity triggering receptor 2
5	9606.ENSP00000371018	0.998	Signal-regulatory protein beta-1
6	9606.ENSP00000371327	0.998	NKG2-C type II integral membrane protein
7	9606.ENSP00000449999	0.997	C-type lectin domain family 5 member A
8	9606.ENSP00000480609	0.997	annotation not available
9	9606.ENSP00000246551	0.995	Hematopoietic cell signal transducer
10	9606.ENSP00000286301	0.995	Macrophage colony-stimulating factor 1 receptor
11	9606.ENSP00000354090	0.995	Sialic acid-binding Ig-like lectin 14
12	9606.ENSP00000371333	0.995	Natural killer cells antigen CD94
13	9606.ENSP00000374125	0.986	Sialic acid-binding Ig-like lectin 15
14	9606.ENSP00000377061	0.986	Plexin-A1
15	9606.ENSP00000264972	0.981	Tyrosine-protein kinase ZAP-70
16	9606.ENSP00000289902	0.981	High affinity immunoglobulin epsilon receptor subunit gamma
17	9606.ENSP00000240618	0.976	Killer cell lectin-like receptor subfamily K, member 1
18	9606.ENSP00000046794	0.953	Lymphocyte cytosolic protein 2
19	9606.ENSP00000341141	0.952	Sialoadhesin
20	9606.ENSP00000305529	0.945	Signal-regulatory protein gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0042803	1.000	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0048518	0.993	positive regulation of biological process
GO:0051716	0.987	cellular response to stimulus
GO:0002682	0.985	regulation of immune system process
GO:0048583	0.984	regulation of response to stimulus
GO:0050865	0.979	regulation of cell activation
GO:0007165	0.976	signal transduction
GO:0050776	0.965	regulation of immune response
GO:0002376	0.961	immune system process
GO:0048584	0.952	positive regulation of response to stimulus
GO:0048522	0.952	positive regulation of cellular process
GO:0006950	0.950	response to stress
GO:0001775	0.948	cell activation
GO:0007166	0.947	cell surface receptor signaling pathway
GO:0002684	0.942	positive regulation of immune system process
GO:0050778	0.933	positive regulation of immune response
GO:0048856	0.930	anatomical structure development
GO:0032879	0.930	regulation of localization
GO:0002274	0.930	myeloid leukocyte activation
GO:0002683	0.929	negative regulation of immune system process
GO:0030888	0.926	regulation of B cell proliferation
GO:0006952	0.919	defense response
GO:0060142	0.918	regulation of syncytium formation by plasma membrane fusion
GO:0051241	0.909	negative regulation of multicellular organismal process
GO:0048523	0.905	negative regulation of cellular process
GO:0002831	0.900	regulation of response to biotic stimulus
GO:0002764	0.899	immune response-regulating signaling pathway
GO:0050866	0.898	negative regulation of cell activation
GO:0031347	0.893	regulation of defense response
GO:0050672	0.887	negative regulation of lymphocyte proliferation
GO:0002573	0.886	myeloid leukocyte differentiation
GO:0002768	0.879	immune response-regulating cell surface receptor signaling pathway
GO:0032101	0.876	regulation of response to external stimulus
GO:0002253	0.871	activation of immune response
GO:0030316	0.866	osteoclast differentiation
GO:0032103	0.861	positive regulation of response to external stimulus
GO:0031349	0.841	positive regulation of defense response
GO:0065008	0.828	regulation of biological quality
GO:0051240	0.748	positive regulation of multicellular organismal process
GO:0002757	0.726	immune response-activating signaling pathway
GO:0045088	0.704	regulation of innate immune response
GO:0009607	0.684	response to biotic stimulus
GO:0019222	0.552	regulation of metabolic process
GO:0060255	0.524	regulation of macromolecule metabolic process
GO:0010468	0.450	regulation of gene expression
GO:0051094	0.449	positive regulation of developmental process
GO:0009893	0.447	positive regulation of metabolic process
GO:0051130	0.445	positive regulation of cellular component organization
GO:0002429	0.438	immune response-activating cell surface receptor signaling pathway
GO:0006955	0.428	immune response
GO:0002833	0.409	positive regulation of response to biotic stimulus
GO:0045089	0.400	positive regulation of innate immune response
GO:0002758	0.386	innate immune response-activating signaling pathway
GO:0010646	0.347	regulation of cell communication
GO:0023051	0.345	regulation of signaling
GO:0042221	0.328	response to chemical
GO:0050869	0.322	negative regulation of B cell activation
GO:0010604	0.318	positive regulation of macromolecule metabolic process
GO:0035556	0.318	intracellular signal transduction
GO:0002220	0.307	innate immune response activating cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.999	endomembrane system
GO:0005737	0.992	cytoplasm
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0031090	0.973	organelle membrane
GO:0098588	0.956	bounding membrane of organelle
GO:0031982	0.945	vesicle
GO:0030141	0.942	secretory granule
GO:0030659	0.940	cytoplasmic vesicle membrane
GO:0009986	0.885	cell surface
GO:0030667	0.636	secretory granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]