StarFunc result for job id O43915

User Input

>input (354 residues)
MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSE
DWKLWRCRLRLKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEV
ASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVP
VKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEE
NPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC
CQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHSRKNP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43915	1.000	1.000	3.197E-68	354	1.000	1.000	O43915.pdb.gz	VEGFD_HUMAN Vascular endothelial growth factor D OS=Homo sapiens OX=9606 GN=VEGFD PE=1 SV=1
2	AFDB:P97946	0.492	0.487	2.005E-53	358	0.845	0.835	P97946.pdb.gz	VEGFD_MOUSE Vascular endothelial growth factor D OS=Mus musculus OX=10090 GN=Vegfd PE=2 SV=1
3	AFDB:O35757	0.437	0.379	3.840E-30	415	0.367	0.313	O35757.pdb.gz	VEGFC_RAT Vascular endothelial growth factor C OS=Rattus norvegicus OX=10116 GN=Vegfc PE=1 SV=2
4	AFDB:P49767	0.452	0.388	4.581E-30	419	0.381	0.322	P49767.pdb.gz	VEGFC_HUMAN Vascular endothelial growth factor C OS=Homo sapiens OX=9606 GN=VEGFC PE=1 SV=1
5	AFDB:Q7T3I6	0.429	0.387	2.966E-27	396	0.339	0.303	Q7T3I6.pdb.gz	Q7T3I6_DANRE Vascular endothelial growth factor C OS=Danio rerio OX=7955 GN=vegfc PE=2 SV=1
6	AFDB:Q208T6	0.476	0.606	3.951E-26	272	0.331	0.430	Q208T6.pdb.gz	Q208T6_DANRE C-fos induced growth factor OS=Danio rerio OX=7955 GN=figf PE=2 SV=1
7	AFDB:E7EZR4	0.262	0.370	3.001E-13	246	0.181	0.260	E7EZR4.pdb.gz	E7EZR4_DANRE Vascular endothelial growth factor A-like OS=Danio rerio OX=7955 GN=vegfba PE=3 SV=1
8	AFDB:Q1ECU5	0.253	0.352	2.808E-12	250	0.153	0.216	Q1ECU5.pdb.gz
9	AFDB:P15692	0.265	0.396	4.769E-12	232	0.175	0.267	P15692.pdb.gz	VEGFA_HUMAN Vascular endothelial growth factor A, long form OS=Homo sapiens OX=9606 GN=VEGFA PE=1 SV=3
10	AFDB:Q5RHW5	0.253	0.388	5.058E-12	228	0.153	0.237	Q5RHW5.pdb.gz
11	PDB:1wq8A	0.253	0.849	1.487E-8	100	0.088	0.310	1wq8A.pdb.gz
12	PDB:1m4uA	0.175	0.285	4.414E-4	199	0.068	0.121	1m4uA.pdb.gz
13	PDB:1hcnB	0.172	0.495	9.986E-3	110	0.048	0.155	1hcnB.pdb.gz
14	PDB:7ag0A	0.155	0.336	1.421E-2	140	0.054	0.136	7ag0A.pdb.gz
15	PDB:5vqfB	0.155	0.169	1.799E-2	320	0.045	0.050	5vqfB.pdb.gz
16	PDB:4my2A	0.180	0.138	2.715E-2	474	0.037	0.027	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
17	PDB:2k8pA	0.174	0.288	6.962E-2	189	0.059	0.111	2k8pA.pdb.gz
18	PDB:7uwmA	0.126	0.275	8.810E-2	109	0.028	0.092	7uwmA.pdb.gz
19	PDB:7y1rB	0.151	0.169	8.810E-2	308	0.037	0.042	7y1rB.pdb.gz
20	PDB:7t9iB	0.149	0.415	1.115E-1	109	0.051	0.165	7t9iB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35251	0.0	567	326	0.763	0.828	VEGFD_RAT Vascular endothelial growth factor D OS=Rattus norvegicus OX=10116 GN=Vegfd PE=1 SV=1
2	O43915	0.0	729	354	1.000	1.000	VEGFD_HUMAN Vascular endothelial growth factor D OS=Homo sapiens OX=9606 GN=VEGFD PE=1 SV=1
3	P97946	0.0	620	358	0.850	0.841	VEGFD_MOUSE Vascular endothelial growth factor D OS=Mus musculus OX=10090 GN=Vegfd PE=2 SV=1
4	P49767	3.03e-74	237	419	0.384	0.325	VEGFC_HUMAN Vascular endothelial growth factor C OS=Homo sapiens OX=9606 GN=VEGFC PE=1 SV=1
5	P97953	9.66e-74	236	415	0.384	0.328	VEGFC_MOUSE Vascular endothelial growth factor C OS=Mus musculus OX=10090 GN=Vegfc PE=1 SV=1
6	O35757	2.54e-71	229	415	0.376	0.320	VEGFC_RAT Vascular endothelial growth factor C OS=Rattus norvegicus OX=10116 GN=Vegfc PE=1 SV=2
7	Q208T6	7.75e-61	198	272	0.322	0.419	Q208T6_DANRE C-fos induced growth factor OS=Danio rerio OX=7955 GN=figf PE=2 SV=1
8	Q7T3I6	2.14e-58	196	396	0.370	0.331	Q7T3I6_DANRE Vascular endothelial growth factor C OS=Danio rerio OX=7955 GN=vegfc PE=2 SV=1
9	Q330K6	1.17e-11	63.9	143	0.088	0.217	TXVE2_PROMU Snake venom vascular endothelial growth factor toxin OS=Protobothrops mucrosquamatus OX=103944 PE=1 SV=1
10	Q00731	1.85e-11	65.1	214	0.107	0.178	VEGFA_MOUSE Vascular endothelial growth factor A, long form OS=Mus musculus OX=10090 GN=Vegfa PE=1 SV=3
11	P83942	3.13e-11	62.0	110	0.088	0.282	TXVE_VIPAP Snake venom vascular endothelial growth factor toxin HF OS=Vipera aspis aspis OX=194601 PE=1 SV=1
12	P16612	4.13e-11	63.9	214	0.105	0.173	VEGFA_RAT Vascular endothelial growth factor A OS=Rattus norvegicus OX=10116 GN=Vegfa PE=1 SV=2
13	P15692	5.17e-11	64.3	232	0.102	0.155	VEGFA_HUMAN Vascular endothelial growth factor A, long form OS=Homo sapiens OX=9606 GN=VEGFA PE=1 SV=3
14	E7EZR4	7.64e-11	63.9	246	0.105	0.150	E7EZR4_DANRE Vascular endothelial growth factor A-like OS=Danio rerio OX=7955 GN=vegfba PE=3 SV=1
15	Q9MYV3	1.12e-10	62.8	214	0.099	0.164	VEGFA_CANLF Vascular endothelial growth factor A OS=Canis lupus familiaris OX=9615 GN=VEGFA PE=1 SV=1
16	P15691	1.39e-10	62.0	190	0.099	0.184	VEGFA_BOVIN Vascular endothelial growth factor A OS=Bos taurus OX=9913 GN=VEGFA PE=1 SV=1
17	P49763	2.59e-10	62.0	221	0.124	0.199	PLGF_HUMAN Placenta growth factor OS=Homo sapiens OX=9606 GN=PGF PE=1 SV=2
18	P67863	2.78e-10	60.1	145	0.088	0.214	TXVE_VIPAA Snake venom vascular endothelial growth factor toxin vammin OS=Vipera ammodytes ammodytes OX=8705 PE=1 SV=2
19	Q63434	2.52e-09	57.8	158	0.096	0.215	PLGF_RAT Placenta growth factor OS=Rattus norvegicus OX=10116 GN=Pgf PE=1 SV=1
20	P49764	6.80e-09	56.6	158	0.093	0.209	PLGF_MOUSE Placenta growth factor OS=Mus musculus OX=10090 GN=Pgf PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03128 CXCXC	17	17.2	CXCXC repeat
2	PF00341 PDGF	5.7e-20	82.7	PDGF/VEGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297904

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261937	0.999	Vascular endothelial growth factor receptor 3
2	9606.ENSP00000263923	0.999	Vascular endothelial growth factor receptor 2
3	9606.ENSP00000282397	0.968	Vascular endothelial growth factor receptor 1
4	9606.ENSP00000264741	0.943	Integrin alpha-9
5	9606.ENSP00000346839	0.937	Fibronectin type III domain containing
6	9606.ENSP00000401303	0.915	SHC-transforming protein 1
7	9606.ENSP00000379350	0.914	Integrin beta-1
8	9606.ENSP00000376345	0.913	Growth factor receptor-bound protein 2
9	9606.ENSP00000293379	0.912	Integrin alpha-5
10	9606.ENSP00000380227	0.912	Integrin alpha-4
11	9606.ENSP00000480043	0.912	Vascular endothelial growth factor C
12	9606.ENSP00000410402	0.910	Dual specificity mitogen-activated protein kinase kinase 4
13	9606.ENSP00000428056	0.910	Phosphatidylinositol 3-kinase regulatory subunit alpha
14	9606.ENSP00000225964	0.908	Collagen alpha-1(I) chain
15	9606.ENSP00000263967	0.908	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
16	9606.ENSP00000282588	0.905	Integrin alpha-1
17	9606.ENSP00000296585	0.902	Integrin alpha-2
18	9606.ENSP00000297268	0.902	Collagen alpha-2(I) chain
19	9606.ENSP00000300574	0.901	Adapter molecule crk
20	9606.ENSP00000387784	0.900	Son of sevenless homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005172	1.000	vascular endothelial growth factor receptor binding
GO:0048018	1.000	receptor ligand activity
GO:0042056	0.909	chemoattractant activity
GO:0008083	0.761	growth factor activity
GO:0042802	0.704	identical protein binding
GO:0005161	0.363	platelet-derived growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048518	0.996	positive regulation of biological process
GO:0048010	0.988	vascular endothelial growth factor receptor signaling pathway
GO:0048522	0.987	positive regulation of cellular process
GO:0048583	0.984	regulation of response to stimulus
GO:0042127	0.978	regulation of cell population proliferation
GO:0032501	0.971	multicellular organismal process
GO:0048856	0.970	anatomical structure development
GO:0009966	0.963	regulation of signal transduction
GO:0008284	0.959	positive regulation of cell population proliferation
GO:0030335	0.933	positive regulation of cell migration
GO:0019222	0.896	regulation of metabolic process
GO:0060255	0.873	regulation of macromolecule metabolic process
GO:0050920	0.860	regulation of chemotaxis
GO:0032103	0.841	positive regulation of response to external stimulus
GO:0007275	0.833	multicellular organism development
GO:0002684	0.823	positive regulation of immune system process
GO:0009893	0.819	positive regulation of metabolic process
GO:0051239	0.802	regulation of multicellular organismal process
GO:0010604	0.787	positive regulation of macromolecule metabolic process
GO:0050793	0.747	regulation of developmental process
GO:0002685	0.739	regulation of leukocyte migration
GO:0050921	0.704	positive regulation of chemotaxis
GO:0048731	0.670	system development
GO:0042221	0.666	response to chemical
GO:0002687	0.625	positive regulation of leukocyte migration
GO:0051240	0.610	positive regulation of multicellular organismal process
GO:0050926	0.594	regulation of positive chemotaxis
GO:0006950	0.567	response to stress
GO:0010468	0.529	regulation of gene expression
GO:0030154	0.527	cell differentiation
GO:0009605	0.477	response to external stimulus
GO:0031323	0.461	regulation of cellular metabolic process
GO:0009653	0.441	anatomical structure morphogenesis
GO:0002688	0.430	regulation of leukocyte chemotaxis
GO:0080090	0.425	regulation of primary metabolic process
GO:0051094	0.425	positive regulation of developmental process
GO:0051171	0.420	regulation of nitrogen compound metabolic process
GO:2000026	0.416	regulation of multicellular organismal development
GO:1901342	0.412	regulation of vasculature development
GO:0048519	0.401	negative regulation of biological process
GO:0023056	0.373	positive regulation of signaling
GO:0010647	0.373	positive regulation of cell communication
GO:0048870	0.372	cell motility
GO:0070887	0.351	cellular response to chemical stimulus
GO:0031325	0.345	positive regulation of cellular metabolic process
GO:1904018	0.340	positive regulation of vasculature development
GO:0048523	0.328	negative regulation of cellular process
GO:0016477	0.327	cell migration
GO:0009967	0.317	positive regulation of signal transduction
GO:0022603	0.309	regulation of anatomical structure morphogenesis
GO:0051173	0.303	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0070013	0.974	intracellular organelle lumen
GO:0012505	0.966	endomembrane system
GO:0043227	0.950	membrane-bounded organelle
GO:0005737	0.933	cytoplasm
GO:0043231	0.900	intracellular membrane-bounded organelle
GO:0031410	0.861	cytoplasmic vesicle
GO:0099503	0.740	secretory vesicle
GO:0034774	0.705	secretory granule lumen
GO:0031091	0.681	platelet alpha granule
GO:0031093	0.665	platelet alpha granule lumen
GO:0071944	0.507	cell periphery
GO:0016020	0.488	membrane
GO:0005886	0.405	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]