StarFunc result for job id O43924

User Input

>input (150 residues)
MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVS
RELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
SVLTGNVIIETKFFDDDLLVSTSRVRLFYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O55057	1.000	1.000	3.923E-31	150	0.980	0.980	O55057.pdb.gz	PDE6D_MOUSE Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Mus musculus OX=10090 GN=Pde6d PE=1 SV=1
2	AFDB:F1QZ52	0.999	0.999	8.018E-30	150	0.907	0.907	F1QZ52.pdb.gz
3	PDB:5nalB	0.980	0.980	1.258E-29	150	1.000	1.000	5nalB.pdb.gz	Covalent Protein Labeling at Glutamic Acids.
4	AFDB:Q18268	0.975	0.920	3.502E-26	159	0.680	0.642	Q18268.pdb.gz	PDL1_CAEEL Phosphodiesterase delta-like protein OS=Caenorhabditis elegans OX=6239 GN=pdl-1 PE=1 SV=1
5	AFDB:Q9VLJ0	0.956	0.950	3.060E-24	151	0.613	0.609	Q9VLJ0.pdb.gz	PDE6D_DROME Probable cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Drosophila melanogaster OX=7227 GN=PrBP PE=1 SV=1
6	PDB:1ksgB	0.734	0.846	1.586E-20	128	0.840	0.984	1ksgB.pdb.gz	The complex of Arl2-GTP and PDE delta: from structure to function.
7	AFDB:G5EGP9	0.783	0.497	5.269E-13	244	0.213	0.131	G5EGP9.pdb.gz	G5EGP9_CAEEL GMP phosphodiesterase delta subunit domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-119 PE=1 SV=1
8	AFDB:Q586Q9	0.808	0.627	5.269E-13	196	0.220	0.168	Q586Q9.pdb.gz	Q586Q9_TRYB2 GMP phosphodiesterase delta subunit domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.290 PE=3 SV=1
9	PDB:4gojC	0.767	0.719	1.808E-12	161	0.220	0.205	4gojC.pdb.gz	Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
10	AFDB:Q9XYQ2	0.777	0.457	2.130E-12	265	0.213	0.121	Q9XYQ2.pdb.gz	UN119_DROME Protein unc-119 homolog OS=Drosophila melanogaster OX=7227 GN=unc-119 PE=2 SV=1
11	AFDB:E7F2M1	0.791	0.468	2.382E-12	261	0.187	0.107	E7F2M1.pdb.gz	E7F2M1_DANRE Protein unc-119 homolog B OS=Danio rerio OX=7955 GN=unc119.2 PE=1 SV=1
12	AFDB:A6NIH7	0.731	0.450	2.519E-12	251	0.213	0.127	A6NIH7.pdb.gz	U119B_HUMAN Protein unc-119 homolog B OS=Homo sapiens OX=9606 GN=UNC119B PE=1 SV=1
13	AFDB:Q90Z08	0.763	0.484	2.664E-12	243	0.233	0.144	Q90Z08.pdb.gz	U119B_DANRE Protein unc-119 homolog B OS=Danio rerio OX=7955 GN=unc119b PE=1 SV=2
14	PDB:4f38B	0.543	0.440	2.789E-6	192	0.160	0.125	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
15	PDB:5kwyC	0.490	0.544	6.741E-5	133	0.080	0.090	5kwyC.pdb.gz	Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
16	PDB:2hkaB	0.468	0.530	2.882E-4	130	0.093	0.108	2hkaB.pdb.gz	Structural Basis of Sterol Binding by NPC2, a Lysosomal Protein Deficient in Niemann-Pick Type C2 Disease
17	PDB:2ag2A	0.342	0.321	3.048E-4	164	0.107	0.098	2ag2A.pdb.gz	Crystal Structure Analysis of Phosphatidylcholine-GM2-Activator Product Complexes: Evidence for Hydrolase Activity.
18	PDB:5f0jB	0.351	0.204	1.165E-3	306	0.080	0.039	5f0jB.pdb.gz
19	PDB:1a9vA	0.438	0.496	1.629E-3	129	0.087	0.101	1a9vA.pdb.gz
20	PDB:3t6qC	0.399	0.424	1.723E-3	139	0.053	0.058	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43924	6.00e-110	310	150	1.000	1.000	PDE6D_HUMAN Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Homo sapiens OX=9606 GN=PDE6D PE=1 SV=1
2	Q95142	2.64e-109	308	150	0.993	0.993	PDE6D_BOVIN Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Bos taurus OX=9913 GN=PDE6D PE=1 SV=1
3	O55057	2.35e-108	306	150	0.980	0.980	PDE6D_MOUSE Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Mus musculus OX=10090 GN=Pde6d PE=1 SV=1
4	Q6DH83	2.11e-101	288	150	0.900	0.900	Q6DH83_DANRE Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Danio rerio OX=7955 GN=zgc:92605 PE=1 SV=1
5	Q18268	2.14e-78	231	159	0.680	0.642	PDL1_CAEEL Phosphodiesterase delta-like protein OS=Caenorhabditis elegans OX=6239 GN=pdl-1 PE=1 SV=1
6	Q9VLJ0	8.28e-67	201	151	0.620	0.616	PDE6D_DROME Probable cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Drosophila melanogaster OX=7227 GN=PrBP PE=1 SV=1
7	Q1RM42	2.94e-06	47.4	264	0.207	0.117	Q1RM42_DANRE Protein unc-119 homolog B OS=Danio rerio OX=7955 GN=unc119.2 PE=2 SV=1
8	Q586Q9	7.54e-06	45.8	196	0.193	0.148	Q586Q9_TRYB2 GMP phosphodiesterase delta subunit domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.290 PE=3 SV=1
9	Q90Z08	2.55e-05	44.7	243	0.140	0.086	U119B_DANRE Protein unc-119 homolog B OS=Danio rerio OX=7955 GN=unc119b PE=1 SV=2
10	Q62885	2.78e-05	44.7	240	0.173	0.108	U119A_RAT Protein unc-119 homolog A OS=Rattus norvegicus OX=10116 GN=Unc119 PE=1 SV=1
11	Q9Z2R6	2.86e-05	44.7	240	0.173	0.108	U119A_MOUSE Protein unc-119 homolog A OS=Mus musculus OX=10090 GN=Unc119 PE=1 SV=1
12	Q13432	3.03e-05	44.7	240	0.173	0.108	U119A_HUMAN Protein unc-119 homolog A OS=Homo sapiens OX=9606 GN=UNC119 PE=1 SV=1
13	A6NIH7	0.001	40.0	251	0.120	0.072	U119B_HUMAN Protein unc-119 homolog B OS=Homo sapiens OX=9606 GN=UNC119B PE=1 SV=1
14	C0P283	0.002	39.3	199	0.193	0.146	C0P283_CAEEL GMP phosphodiesterase delta subunit domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-119 PE=1 SV=1
15	G5EGP9	0.003	38.9	244	0.153	0.094	G5EGP9_CAEEL GMP phosphodiesterase delta subunit domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-119 PE=1 SV=1
16	Q10658	0.003	38.5	219	0.153	0.105	UN119_CAEEL Protein unc-119 OS=Caenorhabditis elegans OX=6239 GN=unc-119 PE=1 SV=1
17	E7F2M1	0.008	37.7	261	0.133	0.077	E7F2M1_DANRE Protein unc-119 homolog B OS=Danio rerio OX=7955 GN=unc119.2 PE=1 SV=1
18	Q9XYQ2	0.010	37.4	265	0.120	0.068	UN119_DROME Protein unc-119 homolog OS=Drosophila melanogaster OX=7227 GN=unc-119 PE=2 SV=1
19	Q6UEH4	2.9	30.0	498	0.220	0.066	AFLU_ASPPU Cytochrome P450 monooxygenase aflU OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflU PE=3 SV=1
20	Q9ZT50	5.3	28.9	155	0.067	0.065	RHA2A_ARATH E3 ubiquitin-protein ligase RHA2A OS=Arabidopsis thaliana OX=3702 GN=RHA2A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05351 GMP_PDE_delta	4.5e-43	158.5	GMP-PDE, delta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010352877.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010354480.1	0.985	Belongs to the small GTPase superfamily. Arf family.
2	61622.XP_010355613.1	0.970	ADP-ribosylation factor-like protein 13B isoform X1
3	61622.XP_010382347.1	0.953	Ras homolog enriched in brain
4	61622.XP_010362261.1	0.949	Belongs to the small GTPase superfamily. Arf family.
5	61622.XP_010364235.1	0.949	Belongs to the small GTPase superfamily. Arf family.
6	61622.XP_010354225.1	0.946	RAB28, member RAS oncogene family
7	61622.XP_010376612.1	0.946	Ras-related protein Rab-28-like
8	61622.XP_010371746.1	0.937	RAB12, member RAS oncogene family
9	61622.XP_010371501.1	0.897	KRAS proto-oncogene, GTPase
10	61622.XP_010374554.1	0.897	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
11	61622.XP_010377741.1	0.897	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
12	61622.XP_010378489.1	0.879	ADP ribosylation factor like GTPase 13A
13	61622.XP_010368362.1	0.878	X-linked retinitis pigmentosa GTPase regulator-like
14	61622.XP_010352136.1	0.843	GTPase HRas isoform X1
15	61622.XP_010366046.1	0.834	Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
16	61622.XP_010362117.1	0.768	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 2 codons
17	61622.XP_010370267.1	0.764	Neuroblastoma RAS viral oncogene homolog
18	61622.XP_010371028.1	0.755	72 kDa inositol polyphosphate 5-phosphatase
19	61622.XP_010356336.1	0.753	Belongs to the adenylyl cyclase class-4/guanylyl cyclase family
20	61622.XP_010356803.1	0.735	Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0031267	0.382	small GTPase binding
GO:0003824	0.332	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.939	multicellular organismal process
GO:0009987	0.919	cellular process
GO:0065007	0.821	biological regulation
GO:0050794	0.812	regulation of cellular process
GO:0048856	0.804	anatomical structure development
GO:0007275	0.603	multicellular organism development
GO:0050896	0.598	response to stimulus
GO:0048731	0.487	system development
GO:0007154	0.460	cell communication
GO:0023052	0.459	signaling
GO:0051716	0.406	cellular response to stimulus
GO:0007165	0.393	signal transduction
GO:0072001	0.307	renal system development
GO:0048513	0.306	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	0.998	cilium
GO:0005737	0.995	cytoplasm
GO:0043229	0.989	intracellular organelle
GO:0005829	0.985	cytosol
GO:0043231	0.984	intracellular membrane-bounded organelle
GO:0016020	0.961	membrane
GO:0005886	0.932	plasma membrane
GO:0031982	0.891	vesicle
GO:0031090	0.788	organelle membrane
GO:0031410	0.576	cytoplasmic vesicle
GO:0043005	0.504	neuron projection
GO:0097731	0.487	9+0 non-motile cilium
GO:0097733	0.483	photoreceptor cell cilium
GO:0098588	0.443	bounding membrane of organelle
GO:0001750	0.403	photoreceptor outer segment
GO:0098590	0.351	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]