StarFunc result for job id O43927

User Input

>input (109 residues)
MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGC
PRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43927	1.000	1.000	2.862E-19	109	1.000	1.000	O43927.pdb.gz	CXL13_HUMAN C-X-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CXCL13 PE=1 SV=1
2	PDB:7jnyA	0.621	0.836	3.978E-12	80	0.688	0.938	7jnyA.pdb.gz
3	AFDB:O55038	0.726	0.726	8.730E-12	109	0.440	0.440	O55038.pdb.gz	CXL13_MOUSE C-X-C motif chemokine 13 OS=Mus musculus OX=10090 GN=Cxcl13 PE=1 SV=1
4	AFDB:A3DTN6	0.610	0.643	6.014E-8	103	0.294	0.311	A3DTN6.pdb.gz	A3DTN6_CHICK Multifunctional fusion protein OS=Gallus gallus OX=9031 GN=IL8 PE=2 SV=2
5	AFDB:P79255	0.664	0.705	8.246E-8	101	0.275	0.297	P79255.pdb.gz	IL8_BOVIN Interleukin-8 OS=Bos taurus OX=9913 GN=CXCL8 PE=3 SV=1
6	PDB:5izbA	0.549	0.660	8.536E-8	89	0.339	0.416	5izbA.pdb.gz
7	AFDB:P19874	0.602	0.639	2.569E-7	101	0.248	0.267	P19874.pdb.gz	IL8_RABIT Interleukin-8 OS=Oryctolagus cuniculus OX=9986 GN=CXCL8 PE=1 SV=2
8	AFDB:P17515	0.590	0.649	3.752E-7	98	0.248	0.276	P17515.pdb.gz	CXL10_MOUSE C-X-C motif chemokine 10 OS=Mus musculus OX=10090 GN=Cxcl10 PE=1 SV=1
9	AFDB:O62812	0.655	0.695	4.256E-7	101	0.239	0.257	O62812.pdb.gz	IL8_HORSE Interleukin-8 OS=Equus caballus OX=9796 GN=CXCL8 PE=1 SV=2
10	AFDB:P02778	0.578	0.636	5.479E-7	98	0.257	0.286	P02778.pdb.gz	CXL10_HUMAN C-X-C motif chemokine 10 OS=Homo sapiens OX=9606 GN=CXCL10 PE=1 SV=2
11	AFDB:P10145	0.600	0.651	7.513E-7	99	0.257	0.283	P10145.pdb.gz	IL8_HUMAN Interleukin-8 OS=Homo sapiens OX=9606 GN=CXCL8 PE=1 SV=1
12	AFDB:Q6W5C0	0.530	0.573	1.097E-6	100	0.229	0.250	Q6W5C0.pdb.gz	CXCL3_MOUSE C-X-C motif chemokine 3 OS=Mus musculus OX=10090 GN=Cxcl3 PE=2 SV=1
13	PDB:1qe6D	0.542	0.782	1.882E-6	72	0.193	0.292	1qe6D.pdb.gz
14	PDB:1o80A	0.561	0.799	5.167E-6	74	0.165	0.243	1o80A.pdb.gz
15	PDB:2mgsA	0.504	0.734	5.341E-5	71	0.147	0.225	2mgsA.pdb.gz
16	PDB:1f9rA	0.502	0.797	1.293E-4	65	0.147	0.246	1f9rA.pdb.gz
17	PDB:1qnkA	0.489	0.735	1.772E-4	69	0.147	0.232	1qnkA.pdb.gz
18	PDB:1bo0A	0.451	0.609	2.757E-4	76	0.183	0.263	1bo0A.pdb.gz
19	PDB:1mgsA	0.522	0.740	2.757E-4	73	0.165	0.247	1mgsA.pdb.gz
20	PDB:1esrA	0.482	0.646	7.570E-4	76	0.128	0.184	1esrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43927	2.17e-74	217	109	1.000	1.000	CXL13_HUMAN C-X-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CXCL13 PE=1 SV=1
2	O55038	1.61e-26	96.3	109	0.367	0.367	CXL13_MOUSE C-X-C motif chemokine 13 OS=Mus musculus OX=10090 GN=Cxcl13 PE=1 SV=1
3	Q9WVL7	8.69e-11	57.4	167	0.284	0.186	CXL15_MOUSE C-X-C motif chemokine 15 OS=Mus musculus OX=10090 GN=Cxcl15 PE=1 SV=1
4	P19874	3.74e-10	54.3	101	0.248	0.267	IL8_RABIT Interleukin-8 OS=Oryctolagus cuniculus OX=9986 GN=CXCL8 PE=1 SV=2
5	A3DTN6	7.40e-09	51.2	103	0.220	0.233	A3DTN6_CHICK Multifunctional fusion protein OS=Gallus gallus OX=9031 GN=IL8 PE=2 SV=2
6	P08317	7.40e-09	51.2	103	0.220	0.233	IL8_CHICK Interleukin-8 OS=Gallus gallus OX=9031 GN=CXCL8 PE=2 SV=1
7	P17515	1.24e-08	50.4	98	0.257	0.286	CXL10_MOUSE C-X-C motif chemokine 10 OS=Mus musculus OX=10090 GN=Cxcl10 PE=1 SV=1
8	O62812	1.90e-08	50.1	101	0.239	0.257	IL8_HORSE Interleukin-8 OS=Equus caballus OX=9796 GN=CXCL8 PE=1 SV=2
9	P10145	3.08e-08	49.3	99	0.220	0.242	IL8_HUMAN Interleukin-8 OS=Homo sapiens OX=9606 GN=CXCL8 PE=1 SV=1
10	P50228	1.57e-07	48.1	132	0.239	0.197	CXCL5_MOUSE C-X-C motif chemokine 5 OS=Mus musculus OX=10090 GN=Cxcl5 PE=1 SV=2
11	P02778	6.92e-07	45.8	98	0.257	0.286	CXL10_HUMAN C-X-C motif chemokine 10 OS=Homo sapiens OX=9606 GN=CXCL10 PE=1 SV=2
12	P80162	1.05e-06	45.8	114	0.220	0.211	CXCL6_HUMAN C-X-C motif chemokine 6 OS=Homo sapiens OX=9606 GN=CXCL6 PE=1 SV=4
13	P79255	1.22e-06	45.4	101	0.239	0.257	IL8_BOVIN Interleukin-8 OS=Bos taurus OX=9913 GN=CXCL8 PE=3 SV=1
14	P12850	1.61e-06	45.1	96	0.193	0.219	GROA_MOUSE Growth-regulated alpha protein OS=Mus musculus OX=10090 GN=Cxcl1 PE=1 SV=1
15	P97885	4.23e-06	44.7	130	0.211	0.177	CXCL5_RAT C-X-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Cxcl5 PE=2 SV=1
16	P14095	6.70e-06	43.1	96	0.183	0.208	GROA_RAT Growth-regulated alpha protein OS=Rattus norvegicus OX=10116 GN=Cxcl1 PE=1 SV=2
17	P48973	9.78e-06	42.7	98	0.202	0.224	CXL10_RAT C-X-C motif chemokine 10 OS=Rattus norvegicus OX=10116 GN=Cxcl10 PE=2 SV=2
18	A9ZPF5	1.95e-05	42.7	119	0.275	0.252	A9ZPF5_DANRE C-C motif chemokine OS=Danio rerio OX=7955 GN=ccl-c5a PE=2 SV=1
19	A2BIR2	2.03e-05	42.4	119	0.275	0.252	A2BIR2_DANRE C-C motif chemokine OS=Danio rerio OX=7955 GN=ccl-c5a PE=3 SV=1
20	P30348	2.20e-05	42.0	100	0.220	0.240	CXCL2_RAT C-X-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Cxcl2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	5e-12	57.1	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286758

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292174	0.998	C-X-C chemokine receptor type 5
2	9606.ENSP00000362795	0.987	C-X-C chemokine receptor type 3
3	9606.ENSP00000305651	0.973	C-X-C motif chemokine 10
4	9606.ENSP00000354901	0.969	C-X-C motif chemokine 9
5	9606.ENSP00000319635	0.951	C-X-C chemokine receptor type 2
6	9606.ENSP00000308815	0.950	C-C motif chemokine 19
7	9606.ENSP00000386884	0.948	C-X-C chemokine receptor type 4
8	9606.ENSP00000306884	0.943	C-X-C motif chemokine 11
9	9606.ENSP00000246657	0.927	C-C chemokine receptor type 7
10	9606.ENSP00000312999	0.909	Guanine nucleotide-binding protein G(i) subunit alpha-2
11	9606.ENSP00000334448	0.900	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
12	9606.ENSP00000481878	0.900	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
13	9606.ENSP00000226524	0.899	Platelet factor 4 variant
14	9606.ENSP00000259607	0.897	C-C motif chemokine 21
15	9606.ENSP00000296029	0.896	Platelet factor 4
16	9606.ENSP00000365048	0.876	Tumor necrosis factor ligand superfamily member 13B
17	9606.ENSP00000292303	0.866	C-C chemokine receptor type 5
18	9606.ENSP00000296140	0.850	C-C chemokine receptor type 1
19	9606.ENSP00000343952	0.844	Chemokine (C-C motif) receptor 6
20	9606.ENSP00000295683	0.843	C-X-C chemokine receptor type 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0005539	0.995	glycosaminoglycan binding
GO:0017134	0.992	fibroblast growth factor binding
GO:0008201	0.992	heparin binding
GO:0048020	0.959	CCR chemokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0002376	0.993	immune system process
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0042221	0.986	response to chemical
GO:0006950	0.985	response to stress
GO:0051716	0.983	cellular response to stimulus
GO:0048522	0.979	positive regulation of cellular process
GO:0009605	0.974	response to external stimulus
GO:0006935	0.950	chemotaxis
GO:0006952	0.946	defense response
GO:0044419	0.935	biological process involved in interspecies interaction between organisms
GO:0007165	0.934	signal transduction
GO:0032501	0.928	multicellular organismal process
GO:0040017	0.928	positive regulation of locomotion
GO:0009607	0.921	response to biotic stimulus
GO:0050900	0.919	leukocyte migration
GO:0048583	0.902	regulation of response to stimulus
GO:0030595	0.901	leukocyte chemotaxis
GO:0002682	0.890	regulation of immune system process
GO:0051707	0.887	response to other organism
GO:0030335	0.882	positive regulation of cell migration
GO:0048584	0.881	positive regulation of response to stimulus
GO:0002684	0.880	positive regulation of immune system process
GO:0002685	0.875	regulation of leukocyte migration
GO:0050920	0.873	regulation of chemotaxis
GO:0032103	0.866	positive regulation of response to external stimulus
GO:0006959	0.848	humoral immune response
GO:0001906	0.847	cell killing
GO:0061844	0.844	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0071674	0.842	mononuclear cell migration
GO:0031640	0.830	killing of cells of another organism
GO:0051239	0.816	regulation of multicellular organismal process
GO:0048519	0.814	negative regulation of biological process
GO:0051241	0.791	negative regulation of multicellular organismal process
GO:0050921	0.787	positive regulation of chemotaxis
GO:0048523	0.785	negative regulation of cellular process
GO:2000401	0.779	regulation of lymphocyte migration
GO:0002687	0.775	positive regulation of leukocyte migration
GO:0002690	0.761	positive regulation of leukocyte chemotaxis
GO:0071677	0.715	positive regulation of mononuclear cell migration
GO:0072676	0.596	lymphocyte migration
GO:2000404	0.577	regulation of T cell migration
GO:0040013	0.536	negative regulation of locomotion
GO:2000403	0.526	positive regulation of lymphocyte migration
GO:2000146	0.497	negative regulation of cell motility
GO:0007166	0.441	cell surface receptor signaling pathway
GO:0030336	0.421	negative regulation of cell migration
GO:0065008	0.402	regulation of biological quality
GO:0032502	0.390	developmental process
GO:0019222	0.390	regulation of metabolic process
GO:0048856	0.381	anatomical structure development
GO:0010033	0.378	response to organic substance
GO:0010632	0.356	regulation of epithelial cell migration
GO:0007267	0.324	cell-cell signaling
GO:0009893	0.319	positive regulation of metabolic process
GO:0060255	0.310	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.711	extracellular space
GO:0005886	0.454	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]