StarFunc result for job id O43933

User Input

>input (1283 residues)
MWGSDRLAGAGGGGAAVTVAFTNARDCFLHLPRRLVAQLHLLQNQAIEVVWSHQPAFLSW
VEGRHFSDQGENVAEINRQVGQKLGLSNGGQVFLKPCSHVVSCQQVEVEPLSADDWEILE
LHAVSLEQHLLDQIRIVFPKAIFPVWVDQQTYIFIQIVALIPAASYGRLETDTKLLIQPK
TRRAKENTFSKADAEYKKLHSYGRDQKGMMKELQTKQLQSNTVGITESNENESEIPVDSS
SVASLWTMIGSIFSFQSEKKQETSWGLTEINAFKNMQSKVVPLDNIFRVCKSQPPSIYNA
SATSVFHKHCAIHVFPWDQEYFDVEPSFTVTYGKLVKLLSPKQQQSKTKQNVLSPEKEKQ
MSEPLDQKKIRSDHNEEDEKACVLQVVWNGLEELNNAIKYTKNVEVLHLGKVWIPDDLRK
RLNIEMHAVVRITPVEVTPKIPRSLKLQPRENLPKDISEEDIKTVFYSWLQQSTTTMLPL
VISEEEFIKLETKDGLKEFSLSIVHSWEKEKDKNIFLLSPNLLQKTTIQVLLDPMVKEEN
SEEIDFILPFLKLSSLGGVNSLGVSSLEHITHSLLGRPLSRQLMSLVAGLRNGALLLTGG
KGSGKSTLAKAICKEAFDKLDAHVERVDCKALRGKRLENIQKTLEVAFSEAVWMQPSVVL
LDDLDLIAGLPAVPEHEHSPDAVQSQRLAHALNDMIKEFISMGSLVALIATSQSQQSLHP
LLVSAQGVHIFQCVQHIQPPNQEQRCEILCNVIKNKLDCDINKFTDLDLQHVAKETGGFV
ARDFTVLVDRAIHSRLSRQSISTREKLVLTTLDFQKALRGFLPASLRSVNLHKPRDLGWD
KIGGLHEVRQILMDTIQLPAKYPELFANLPIRQRTGILLYGPPGTGKTLLAGVIARESRM
NFISVKGPELLSKYIGASEQAVRDIFIRAQAAKPCILFFDEFESIAPRRGHDNTGVTDRV
VNQLLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGRLDKCVYCPPPDQVSRLEILNVL
SDSLPLADDVDLQHVASVTDSFTGADLKALLYNAQLEALHGMLLSSGLQDGSSSSDSDLS
LSSMVFLNHSSGSDDSAGDGECGLDQSLVSLEMSEILPDESKFNMYRLYFGSSYESELGN
GTSSDLSSQCLSAPSSMTQDLPGVPGKDQLFSQPPVLRTASQEGCQELTQEQRDQLRADI
SIIKGRYRSQSGEDESMNQPGPIKTRLAISQSHLMTALGHTRPSISEDDWKNFAELYESF
QNPKRRKNQSGTMFRPGQKVTLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0C4DG33	0.639	0.667	0.000	1226	0.954	0.998	A0A0C4DG33.pdb.gz	A0A0C4DG33_HUMAN Peroxisomal ATPase PEX1 OS=Homo sapiens OX=9606 GN=PEX1 PE=1 SV=1
2	AFDB:O43933	1.000	1.000	0.000	1283	1.000	1.000	O43933.pdb.gz	PEX1_HUMAN Peroxisomal ATPase PEX1 OS=Homo sapiens OX=9606 GN=PEX1 PE=1 SV=1
3	AFDB:Q5BL07	0.817	0.817	0.000	1284	0.820	0.819	Q5BL07.pdb.gz	PEX1_MOUSE Peroxisomal ATPase PEX1 OS=Mus musculus OX=10090 GN=Pex1 PE=1 SV=2
4	AFDB:C8V3A3	0.485	0.505	2.781E-87	1225	0.274	0.287	C8V3A3.pdb.gz	C8V3A3_EMENI Peroxisomal ATPase PEX1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05991 PE=4 SV=1
5	AFDB:A0A1D8PR43	0.508	0.590	1.003E-84	1090	0.249	0.294	A0A1D8PR43.pdb.gz	A0A1D8PR43_CANAL Peroxisomal ATPase PEX1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PEX1 PE=4 SV=1
6	AFDB:Q9FNP1	0.473	0.532	1.604E-78	1130	0.257	0.292	Q9FNP1.pdb.gz	PEX1_ARATH Peroxisomal ATPase PEX1 OS=Arabidopsis thaliana OX=3702 GN=PEX1 PE=1 SV=2
7	AFDB:Q9VUC7	0.504	0.632	2.555E-76	1006	0.219	0.279	Q9VUC7.pdb.gz	Q9VUC7_DROME Peroxisomal ATPase PEX1 OS=Drosophila melanogaster OX=7227 GN=Pex1 PE=2 SV=1
8	AFDB:Q581V6	0.390	0.538	2.231E-61	911	0.196	0.277	Q581V6.pdb.gz	Q581V6_TRYB2 Peroxisomal ATPase PEX1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.350 PE=4 SV=1
9	AFDB:P54812	0.375	0.565	9.518E-55	810	0.165	0.262	P54812.pdb.gz	TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans OX=6239 GN=cdc-48.2 PE=1 SV=2
10	AFDB:Q9SCN8	0.350	0.521	9.518E-55	815	0.164	0.259	Q9SCN8.pdb.gz	CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana OX=3702 GN=CDC48D PE=1 SV=1
11	PDB:7vcsA	0.280	0.409	8.956E-47	766	0.175	0.292	7vcsA.pdb.gz	Cryo-EM structures of human p97 double hexamer capture potentiated ATPase-competent state.
12	PDB:6opcB	0.355	0.596	2.665E-46	741	0.160	0.277	6opcB.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
13	PDB:7ln6F	0.257	0.366	7.415E-45	714	0.148	0.266	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
14	PDB:7z11D	0.374	0.628	5.212E-43	734	0.150	0.263	7z11D.pdb.gz	Visualizing maturation factor extraction from the nascent ribosome by the AAA-ATPase Drg1.
15	PDB:5ifwB	0.217	0.366	1.638E-42	702	0.160	0.292	5ifwB.pdb.gz	Quantitative interaction mapping reveals an extended UBX domain in ASPL that disrupts functional p97 hexamers.
16	PDB:7mhsE	0.317	0.765	1.067E-34	489	0.133	0.350	7mhsE.pdb.gz	Active conformation of the p97-p47 unfoldase complex.
17	PDB:6opcF	0.264	0.431	1.841E-34	681	0.148	0.279	6opcF.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
18	PDB:6oaaE	0.305	0.804	4.257E-27	442	0.122	0.353	6oaaE.pdb.gz	Substrate processing by the Cdc48 ATPase complex is initiated by ubiquitin unfolding.
19	PDB:6mdmD	0.291	0.481	6.259E-23	713	0.102	0.184	6mdmD.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.
20	PDB:5l4gL	0.176	0.562	1.256E-21	389	0.070	0.231	5l4gL.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DG33	0.0	2448	1226	0.940	0.984	A0A0C4DG33_HUMAN Peroxisomal ATPase PEX1 OS=Homo sapiens OX=9606 GN=PEX1 PE=1 SV=1
2	A0A8I6ADS4	0.0	2009	1243	0.790	0.816	A0A8I6ADS4_RAT Peroxisomal ATPase PEX1 OS=Rattus norvegicus OX=10116 GN=Pex1 PE=1 SV=1
3	A0A8I6ALA5	0.0	1872	1206	0.734	0.781	A0A8I6ALA5_RAT Peroxisomal ATPase PEX1 OS=Rattus norvegicus OX=10116 GN=Pex1 PE=1 SV=1
4	D3ZZB2	0.0	2097	1283	0.816	0.816	D3ZZB2_RAT Peroxisomal ATPase PEX1 OS=Rattus norvegicus OX=10116 GN=Pex1 PE=1 SV=1
5	O43933	0.0	2640	1283	1.000	1.000	PEX1_HUMAN Peroxisomal ATPase PEX1 OS=Homo sapiens OX=9606 GN=PEX1 PE=1 SV=1
6	Q5BL07	0.0	2110	1284	0.821	0.820	PEX1_MOUSE Peroxisomal ATPase PEX1 OS=Mus musculus OX=10090 GN=Pex1 PE=1 SV=2
7	A0A1D8PR43	3.41e-120	402	1090	0.168	0.198	A0A1D8PR43_CANAL Peroxisomal ATPase PEX1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PEX1 PE=4 SV=1
8	C8V3A3	1.44e-111	381	1225	0.175	0.184	C8V3A3_EMENI Peroxisomal ATPase PEX1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05991 PE=4 SV=1
9	Q9FNP1	2.73e-108	370	1130	0.171	0.195	PEX1_ARATH Peroxisomal ATPase PEX1 OS=Arabidopsis thaliana OX=3702 GN=PEX1 PE=1 SV=2
10	P24004	2.15e-104	357	1043	0.166	0.204	PEX1_YEAST Peroxisomal ATPase PEX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEX1 PE=1 SV=2
11	Q9Y090	1.77e-97	337	1006	0.150	0.192	Q9Y090_DROME Peroxisomal ATPase PEX1 OS=Drosophila melanogaster OX=7227 GN=Pex1 PE=2 SV=1
12	Q9VUC7	1.84e-97	337	1006	0.150	0.192	Q9VUC7_DROME Peroxisomal ATPase PEX1 OS=Drosophila melanogaster OX=7227 GN=Pex1 PE=2 SV=1
13	O74941	3.20e-84	298	937	0.146	0.200	PEX1_SCHPO Peroxisomal ATPase pex1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pex1 PE=3 SV=1
14	Q581V6	1.29e-80	287	911	0.142	0.200	Q581V6_TRYB2 Peroxisomal ATPase PEX1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.350 PE=4 SV=1
15	Q9SCN8	7.48e-79	280	815	0.146	0.229	CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana OX=3702 GN=CDC48D PE=1 SV=1
16	Q9P3A7	1.23e-77	276	815	0.139	0.218	CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc48 PE=1 SV=2
17	Q59WG3	3.75e-77	275	826	0.135	0.209	Q59WG3_CANAL AAA family ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC48 PE=4 SV=1
18	Q9LZF6	3.76e-77	275	810	0.143	0.227	CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana OX=3702 GN=CDC48E PE=2 SV=2
19	O44008	2.14e-76	272	780	0.129	0.213	O44008_9TRYP Valosin-containing protein homolog OS=Trypanosoma brucei OX=5691 GN=VCP PE=4 SV=1
20	P90532	2.37e-76	272	793	0.136	0.221	P90532_DICDI Cell division cycle protein 48 OS=Dictyostelium discoideum OX=44689 GN=cdcD PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.9e-55	198.3	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	0.00039	31.8	AAA domain
3	PF13191 AAA_16	1.7e-06	40.0	AAA ATPase domain
4	PF13207 AAA_17	61	15.5	AAA domain
5	PF13238 AAA_18	0.046	25.7	AAA domain
6	PF13245 AAA_19	0.0088	27.7	AAA domain
7	PF07724 AAA_2	0.0059	28.2	AAA domain (Cdc48 subfamily)
8	PF13401 AAA_22	0.025	26.3	AAA domain
9	PF13479 AAA_24	3.7	18.7	AAA domain
10	PF13481 AAA_25	2	19.5	AAA domain
11	PF13521 AAA_28	5.2	18.8	AAA domain
12	PF13555 AAA_29	0.39	21.8	P-loop containing region of AAA domain
13	PF13604 AAA_30	6.6	17.9	AAA domain
14	PF13671 AAA_33	0.26	22.9	AAA domain
15	PF07728 AAA_5	0.033	25.6	AAA domain (dynein-related subfamily)
16	PF12775 AAA_7	1.4	19.9	P-loop containing dynein motor region
17	PF17862 AAA_lid_3	6.4e-08	43.6	AAA+ lid domain
18	PF00005 ABC_tran	0.0044	29.0	ABC transporter
19	PF01583 APS_kinase	1.1e+02	14.1	Adenylylsulphate kinase
20	PF06745 ATPase	36	15.2	KaiC

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000248633

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303511	0.997	Peroxisome assembly factor 2
2	9606.ENSP00000391601	0.986	Peroxisomal targeting signal 1 receptor
3	9606.ENSP00000295030	0.981	Peroxisomal membrane protein PEX13
4	9606.ENSP00000331106	0.979	Peroxisome assembly protein 26
5	9606.ENSP00000482609	0.974	Peroxisome assembly protein 12
6	9606.ENSP00000288774	0.970	Peroxisome biogenesis factor 10
7	9606.ENSP00000349016	0.966	Peroxisomal membrane protein PEX14
8	9606.ENSP00000349543	0.963	Peroxisome biogenesis factor 2
9	9606.ENSP00000315680	0.954	Peroxisomal targeting signal 2 receptor
10	9606.ENSP00000357051	0.909	Peroxisomal biogenesis factor 19
11	9606.ENSP00000356563	0.901	Peroxisomal biogenesis factor 3
12	9606.ENSP00000241041	0.886	Peroxisomal membrane protein PEX16
13	9606.ENSP00000419975	0.856	PEX5-related protein
14	9606.ENSP00000300056	0.804	Peroxisomal membrane protein 11A
15	9606.ENSP00000261749	0.781	AN1-type zinc finger protein 6
16	9606.ENSP00000359233	0.780	ATP-binding cassette sub-family D member 3
17	9606.ENSP00000358312	0.774	Peroxisomal membrane protein 11B
18	9606.ENSP00000262294	0.724	E3 ubiquitin-protein ligase TRIM37
19	9606.ENSP00000390722	0.702	Peroxisomal membrane protein PMP34
20	9606.ENSP00000333664	0.698	3-ketoacyl-CoA thiolase, peroxisomal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0043168	1.000	anion binding
GO:0032555	1.000	purine ribonucleotide binding
GO:0016887	0.999	ATP hydrolysis activity
GO:0140318	0.998	protein transporter activity
GO:0032559	0.994	adenyl ribonucleotide binding
GO:0035639	0.992	purine ribonucleoside triphosphate binding
GO:0140035	0.989	ubiquitination-like modification-dependent protein binding
GO:0005524	0.982	ATP binding
GO:0140036	0.626	ubiquitin-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0016043	0.996	cellular component organization
GO:0071702	0.986	organic substance transport
GO:0007031	0.986	peroxisome organization
GO:0015031	0.975	protein transport
GO:0043574	0.964	peroxisomal transport
GO:0006886	0.954	intracellular protein transport
GO:0072594	0.947	establishment of protein localization to organelle
GO:0015919	0.945	peroxisomal membrane transport
GO:0016558	0.943	protein import into peroxisome matrix
GO:0043112	0.884	receptor metabolic process
GO:0044238	0.578	primary metabolic process
GO:0007017	0.556	microtubule-based process
GO:0065007	0.401	biological regulation
GO:0051640	0.394	organelle localization
GO:0050794	0.360	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005777	1.000	peroxisome
GO:0016020	0.987	membrane
GO:0005829	0.947	cytosol
GO:0031090	0.925	organelle membrane
GO:0005778	0.898	peroxisomal membrane
GO:0005576	0.796	extracellular region
GO:0031982	0.673	vesicle
GO:0070013	0.660	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.999	ATP + H2O = ADP + H(+) + phosphate

[back to server]