StarFunc result for job id O60216

User Input

>input (631 residues)
MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLL
LGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQP
LPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQENDFGDFGMDDREIMREGSAFEDD
DMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGG
IFDDPPALSEAGVMLPEQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNE
EEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKL
MMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
ENPEVPREDQQQQHQQRDVIDEPIIEEPSRLQESVMEASRTNIDESAMPPPPPQGVKRKA
GQIDPEPVMPPQQVEQMEIPPVELPPEEPPNICQLIPELELLPEKEKEKEKEKEDDEEEE
DEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSF
LVLKKQQAIELTQEEPYSDIIATPGPRFHII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61550	0.376	0.374	2.696E-85	635	0.971	0.965	Q61550.pdb.gz	RAD21_MOUSE Double-strand-break repair protein rad21 homolog OS=Mus musculus OX=10090 GN=Rad21 PE=1 SV=3
2	AFDB:Q6TEL1	0.371	0.365	1.412E-67	643	0.746	0.733	Q6TEL1.pdb.gz	RA21A_DANRE Double-strand-break repair protein rad21 homolog A OS=Danio rerio OX=7955 GN=rad21a PE=1 SV=1
3	AFDB:A2AU37	0.276	0.309	2.514E-40	552	0.395	0.451	A2AU37.pdb.gz	RD21L_MOUSE Double-strand-break repair protein rad21-like protein 1 OS=Mus musculus OX=10090 GN=Rad21l1 PE=1 SV=2
4	AFDB:O96689	0.174	0.154	8.915E-39	715	0.407	0.359	O96689.pdb.gz	O96689_DROME FI11703p OS=Drosophila melanogaster OX=7227 GN=vtd PE=1 SV=1
5	AFDB:Q19325	0.149	0.146	1.398E-29	645	0.315	0.309	Q19325.pdb.gz	SCC1_CAEEL Sister chromatid cohesion protein 1 OS=Caenorhabditis elegans OX=6239 GN=scc-1 PE=1 SV=1
6	PDB:6wg3C	0.124	0.304	3.526E-23	248	0.388	0.988	6wg3C.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
7	AFDB:P30776	0.157	0.158	5.260E-21	628	0.254	0.255	P30776.pdb.gz	RAD21_SCHPO Cohesin subunit rad21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad21 PE=1 SV=1
8	AFDB:Q9FQ19	0.156	0.143	1.865E-19	693	0.231	0.211	Q9FQ19.pdb.gz	SCC13_ARATH Sister chromatid cohesion 1 protein 3 OS=Arabidopsis thaliana OX=3702 GN=SYN3 PE=2 SV=2
9	AFDB:G0SCB6	0.156	0.153	2.173E-17	645	0.257	0.251	G0SCB6.pdb.gz	G0SCB6_CHATD Putative cohesin complex protein OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0056640 PE=1 SV=1
10	AFDB:Q9S7T7	0.166	0.167	7.513E-14	627	0.211	0.212	Q9S7T7.pdb.gz	SCC11_ARATH Sister chromatid cohesion 1 protein 1 OS=Arabidopsis thaliana OX=3702 GN=SYN1 PE=2 SV=2
11	AFDB:Q8W1Y0	0.179	0.119	1.628E-13	1031	0.309	0.189	Q8W1Y0.pdb.gz	SSC14_ARATH Sister chromatid cohesion 1 protein 4 OS=Arabidopsis thaliana OX=3702 GN=SYN4 PE=2 SV=1
12	PDB:6wgeC	0.125	0.427	1.239E-11	174	0.273	0.989	6wgeC.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
13	PDB:6yufB	0.125	0.487	9.202E-5	152	0.076	0.316	6yufB.pdb.gz	A Structure-Based Mechanism for DNA Entry into the Cohesin Ring.
14	PDB:6qpqD	0.100	0.710	9.359E-4	82	0.024	0.183	6qpqD.pdb.gz
15	PDB:5znxA	0.064	0.350	1.755E-1	95	0.011	0.074	5znxA.pdb.gz
16	PDB:5aj0BZ	0.081	0.452	1.862E-1	86	0.017	0.128	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
17	PDB:5v8f4	0.093	0.080	1.976E-1	741	0.014	0.012	5v8f4.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
18	PDB:6iwtA	0.087	0.153	2.507E-1	346	0.019	0.035	6iwtA.pdb.gz
19	PDB:7dl8A	0.068	0.311	3.583E-1	114	0.017	0.096	7dl8A.pdb.gz
20	PDB:7ctfA	0.091	0.482	4.545E-1	102	0.013	0.078	7ctfA.pdb.gz	Structural insight into the assembly and conformational activation of human origin recognition complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60216	0.0	1289	631	1.000	1.000	RAD21_HUMAN Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2
2	Q61550	0.0	1249	635	0.973	0.967	RAD21_MOUSE Double-strand-break repair protein rad21 homolog OS=Mus musculus OX=10090 GN=Rad21 PE=1 SV=3
3	Q6TEL1	0.0	896	643	0.765	0.751	RA21A_DANRE Double-strand-break repair protein rad21 homolog A OS=Danio rerio OX=7955 GN=rad21a PE=1 SV=1
4	A2AU37	1.51e-139	419	552	0.423	0.484	RD21L_MOUSE Double-strand-break repair protein rad21-like protein 1 OS=Mus musculus OX=10090 GN=Rad21l1 PE=1 SV=2
5	Q9U6D9	9.07e-129	397	715	0.429	0.379	Q9U6D9_DROME Mitotic cohesin SCC1 OS=Drosophila melanogaster OX=7227 GN=vtd PE=2 SV=1
6	O96689	9.47e-129	397	715	0.429	0.379	O96689_DROME FI11703p OS=Drosophila melanogaster OX=7227 GN=vtd PE=1 SV=1
7	Q9UB09	1.98e-128	396	715	0.429	0.379	Q9UB09_DROME DNA repair protein Rad21 OS=Drosophila melanogaster OX=7227 GN=vtd PE=2 SV=1
8	A0A021WW32	1.91e-117	365	633	0.342	0.341	A0A021WW32_DROME Verthandi, isoform B OS=Drosophila melanogaster OX=7227 GN=vtd PE=1 SV=1
9	Q19325	2.43e-56	203	645	0.236	0.231	SCC1_CAEEL Sister chromatid cohesion protein 1 OS=Caenorhabditis elegans OX=6239 GN=scc-1 PE=1 SV=1
10	Q8W1Y0	8.23e-37	149	1031	0.120	0.074	SSC14_ARATH Sister chromatid cohesion 1 protein 4 OS=Arabidopsis thaliana OX=3702 GN=SYN4 PE=2 SV=1
11	P30776	1.78e-34	140	628	0.105	0.105	RAD21_SCHPO Cohesin subunit rad21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad21 PE=1 SV=1
12	G0SCB6	1.61e-29	126	645	0.119	0.116	G0SCB6_CHATD Putative cohesin complex protein OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0056640 PE=1 SV=1
13	Q9FQ19	4.16e-25	112	693	0.095	0.087	SCC13_ARATH Sister chromatid cohesion 1 protein 3 OS=Arabidopsis thaliana OX=3702 GN=SYN3 PE=2 SV=2
14	Q57XR0	4.18e-20	96.7	584	0.071	0.077	Q57XR0_TRYB2 Double-strand-break repair protein rad21 homolog, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.570 PE=3 SV=1
15	Q9FQ20	6.67e-19	93.6	810	0.074	0.058	SCC12_ARATH Sister chromatid cohesion 1 protein 2 OS=Arabidopsis thaliana OX=3702 GN=SYN2 PE=2 SV=2
16	A0A1D8PU88	5.37e-17	87.0	564	0.078	0.087	A0A1D8PU88_CANAL Kleisin alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MCD1 PE=3 SV=1
17	Q9S7T7	1.07e-14	79.7	627	0.071	0.072	SCC11_ARATH Sister chromatid cohesion 1 protein 1 OS=Arabidopsis thaliana OX=3702 GN=SYN1 PE=2 SV=2
18	Q12158	3.96e-09	62.0	566	0.048	0.053	SCC1_YEAST Sister chromatid cohesion protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MCD1 PE=1 SV=1
19	Q757M9	2.04e-07	56.6	597	0.051	0.054	Q757M9_EREGS AEL007Wp OS=Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=AGOS_AEL007W PE=1 SV=2
20	Q6AYJ4	7.89e-06	51.2	593	0.044	0.047	REC8_RAT Meiotic recombination protein REC8 homolog OS=Rattus norvegicus OX=10116 GN=Rec8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04824 Rad21_Rec8	2.6e-19	79.6	Conserved region of Rad21 / Rec8 like protein
2	PF04825 Rad21_Rec8_N	8.1e-37	137.1	N terminus of Rad21 / Rec8 like protein
3	PF02616 SMC_ScpA	1.8	20.0	Segregation and condensation protein ScpA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297338

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000218089	0.999	Cohesin subunit SA-2
2	9606.ENSP00000282516	0.999	Nipped-B-like protein
3	9606.ENSP00000303427	0.999	Sister chromatid cohesion protein PDS5 homolog A
4	9606.ENSP00000323421	0.999	Structural maintenance of chromosomes protein 1A
5	9606.ENSP00000350036	0.999	Structural maintenance of chromosomes protein 1B
6	9606.ENSP00000354720	0.999	Structural maintenance of chromosomes protein 3
7	9606.ENSP00000354957	0.999	Structural maintenance of chromosomes protein 5
8	9606.ENSP00000372689	0.999	Cohesin subunit SA-1
9	9606.ENSP00000298767	0.997	Wings apart-like protein homolog
10	9606.ENSP00000313851	0.997	Sister chromatid cohesion protein PDS5 homolog B
11	9606.ENSP00000477973	0.997	Cohesin subunit SA-3
12	9606.ENSP00000264010	0.996	Transcriptional repressor CTCF
13	9606.ENSP00000257934	0.995	Separin
14	9606.ENSP00000269214	0.992	N-acetyltransferase ESCO1
15	9606.ENSP00000306999	0.990	N-acetyltransferase ESCO2
16	9606.ENSP00000404092	0.990	Structural maintenance of chromosomes protein 6
17	9606.ENSP00000275517	0.983	Sororin
18	9606.ENSP00000349961	0.983	Structural maintenance of chromosomes protein 4
19	9606.ENSP00000350447	0.973	Shugoshin 2
20	9606.ENSP00000330694	0.971	Non-structural maintenance of chromosomes element 3 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.951	heterocyclic compound binding
GO:0097159	0.949	organic cyclic compound binding
GO:0003676	0.937	nucleic acid binding
GO:0003677	0.821	DNA binding
GO:0043565	0.463	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0033044	0.984	regulation of chromosome organization
GO:0071840	0.969	cellular component organization or biogenesis
GO:0071704	0.961	organic substance metabolic process
GO:0051171	0.959	regulation of nitrogen compound metabolic process
GO:0016043	0.950	cellular component organization
GO:0048518	0.945	positive regulation of biological process
GO:0022402	0.919	cell cycle process
GO:0006996	0.916	organelle organization
GO:0043170	0.894	macromolecule metabolic process
GO:0080090	0.892	regulation of primary metabolic process
GO:0010564	0.891	regulation of cell cycle process
GO:0031323	0.888	regulation of cellular metabolic process
GO:0048285	0.869	organelle fission
GO:0006807	0.851	nitrogen compound metabolic process
GO:0044238	0.842	primary metabolic process
GO:0019219	0.826	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.817	response to stimulus
GO:0048522	0.810	positive regulation of cellular process
GO:1901987	0.794	regulation of cell cycle phase transition
GO:0044237	0.792	cellular metabolic process
GO:2001252	0.782	positive regulation of chromosome organization
GO:0048519	0.767	negative regulation of biological process
GO:0010948	0.762	negative regulation of cell cycle process
GO:0051716	0.750	cellular response to stimulus
GO:0051983	0.703	regulation of chromosome segregation
GO:0000280	0.667	nuclear division
GO:0046483	0.635	heterocycle metabolic process
GO:0006725	0.634	cellular aromatic compound metabolic process
GO:0010468	0.633	regulation of gene expression
GO:0010556	0.624	regulation of macromolecule biosynthetic process
GO:0031326	0.624	regulation of cellular biosynthetic process
GO:0051252	0.607	regulation of RNA metabolic process
GO:2001141	0.586	regulation of RNA biosynthetic process
GO:0007346	0.552	regulation of mitotic cell cycle
GO:0006355	0.531	regulation of DNA-templated transcription
GO:0034641	0.522	cellular nitrogen compound metabolic process
GO:1901360	0.521	organic cyclic compound metabolic process
GO:1905818	0.513	regulation of chromosome separation
GO:0006139	0.501	nucleobase-containing compound metabolic process
GO:0006357	0.494	regulation of transcription by RNA polymerase II
GO:0090304	0.485	nucleic acid metabolic process
GO:0010639	0.475	negative regulation of organelle organization
GO:0051173	0.449	positive regulation of nitrogen compound metabolic process
GO:0010604	0.442	positive regulation of macromolecule metabolic process
GO:0031325	0.393	positive regulation of cellular metabolic process
GO:0051276	0.390	chromosome organization
GO:0006974	0.355	cellular response to DNA damage stimulus
GO:1901988	0.346	negative regulation of cell cycle phase transition
GO:1903047	0.345	mitotic cell cycle process
GO:0044260	0.335	cellular macromolecule metabolic process
GO:0033045	0.314	regulation of sister chromatid segregation
GO:0006259	0.314	DNA metabolic process
GO:0034502	0.309	protein localization to chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0005694	0.993	chromosome
GO:0044815	0.930	DNA packaging complex
GO:0005737	0.901	cytoplasm
GO:0008278	0.887	cohesin complex
GO:0016020	0.882	membrane
GO:0098687	0.833	chromosomal region
GO:0005829	0.831	cytosol
GO:0000228	0.784	nuclear chromosome
GO:0000793	0.772	condensed chromosome
GO:0000785	0.766	chromatin
GO:0000775	0.721	chromosome, centromeric region
GO:0030496	0.687	midbody
GO:0000794	0.514	condensed nuclear chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]