StarFunc result for job id O60220

User Input

>input (97 residues)
MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAE
ACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60220	1.000	1.000	2.037E-13	97	1.000	1.000	O60220.pdb.gz	TIM8A_HUMAN Mitochondrial import inner membrane translocase subunit Tim8 A OS=Homo sapiens OX=9606 GN=TIMM8A PE=1 SV=1
2	AFDB:Q4FZG7	0.797	0.797	9.674E-9	97	0.742	0.742	Q4FZG7.pdb.gz	TI8AB_MOUSE Putative mitochondrial import inner membrane translocase subunit Tim8 A-B OS=Mus musculus OX=10090 GN=Timm8a2 PE=3 SV=1
3	AFDB:P62077	0.698	0.814	8.671E-5	83	0.340	0.398	P62077.pdb.gz	TIM8B_MOUSE Mitochondrial import inner membrane translocase subunit Tim8 B OS=Mus musculus OX=10090 GN=Timm8b PE=1 SV=1
4	AFDB:Q9Y1A3	0.698	0.764	1.620E-4	88	0.330	0.364	Q9Y1A3.pdb.gz	TIM8_DROME Mitochondrial import inner membrane translocase subunit Tim8 OS=Drosophila melanogaster OX=7227 GN=Tim8 PE=3 SV=1
5	AFDB:Q9N408	0.694	0.803	2.458E-4	83	0.299	0.349	Q9N408.pdb.gz	TIM8_CAEEL Mitochondrial import inner membrane translocase subunit Tim8 OS=Caenorhabditis elegans OX=6239 GN=ddp-1 PE=3 SV=1
6	AFDB:Q9XGY4	0.638	0.788	3.028E-4	77	0.227	0.286	Q9XGY4.pdb.gz	TIM8_ARATH Mitochondrial import inner membrane translocase subunit TIM8 OS=Arabidopsis thaliana OX=3702 GN=TIM8 PE=1 SV=1
7	AFDB:Q09783	0.703	0.696	6.970E-4	98	0.320	0.316	Q09783.pdb.gz	TIM8_SCHPO Mitochondrial import inner membrane translocase subunit tim8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim8 PE=3 SV=1
8	AFDB:P57744	0.665	0.737	9.865E-4	87	0.299	0.333	P57744.pdb.gz	TIM8_YEAST Mitochondrial import inner membrane translocase subunit TIM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM8 PE=1 SV=1
9	AFDB:P62075	0.588	0.600	1.497E-3	95	0.289	0.295	P62075.pdb.gz	TIM13_MOUSE Mitochondrial import inner membrane translocase subunit Tim13 OS=Mus musculus OX=10090 GN=Timm13 PE=1 SV=1
10	AFDB:Q9XH48	0.615	0.677	1.604E-3	87	0.247	0.276	Q9XH48.pdb.gz	TIM13_ARATH Mitochondrial import inner membrane translocase subunit TIM13 OS=Arabidopsis thaliana OX=3702 GN=TIM13 PE=1 SV=2
11	PDB:6lo8E	0.559	0.663	3.316E-2	80	0.206	0.250	6lo8E.pdb.gz
12	PDB:2bskD	0.567	0.602	5.031E-2	90	0.144	0.156	2bskD.pdb.gz
13	PDB:7cgpJ	0.559	0.639	7.120E-2	83	0.175	0.205	7cgpJ.pdb.gz
14	PDB:2bskC	0.549	0.663	1.158E-1	79	0.124	0.152	2bskC.pdb.gz
15	PDB:6lo8H	0.544	0.683	2.019E-1	74	0.144	0.189	6lo8H.pdb.gz
16	PDB:6lo8F	0.510	0.577	4.044E-1	84	0.175	0.202	6lo8F.pdb.gz
17	PDB:5z56A	0.268	0.024	3.250	2232	0.134	0.006	5z56A.pdb.gz	Structure of the human activated spliceosome in three conformational states.
18	PDB:5z57A	0.268	0.026	3.250	1978	0.134	0.007	5z57A.pdb.gz	Structure of the human activated spliceosome in three conformational states.
19	PDB:6sgaFW	0.298	0.130	3.250	247	0.134	0.053	6sgaFW.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
20	PDB:3ojaA	0.326	0.075	3.735	482	0.103	0.021	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60220	2.30e-68	201	97	1.000	1.000	TIM8A_HUMAN Mitochondrial import inner membrane translocase subunit Tim8 A OS=Homo sapiens OX=9606 GN=TIMM8A PE=1 SV=1
2	Q9WVA2	4.07e-61	182	97	0.948	0.948	TIM8A_MOUSE Mitochondrial import inner membrane translocase subunit Tim8 A OS=Mus musculus OX=10090 GN=Timm8a1 PE=1 SV=1
3	Q9WVA1	1.71e-60	181	97	0.948	0.948	TIM8A_RAT Mitochondrial import inner membrane translocase subunit Tim8 A OS=Rattus norvegicus OX=10116 GN=Timm8a PE=1 SV=1
4	Q4FZG7	1.96e-51	158	97	0.742	0.742	TI8AB_MOUSE Putative mitochondrial import inner membrane translocase subunit Tim8 A-B OS=Mus musculus OX=10090 GN=Timm8a2 PE=3 SV=1
5	P62077	4.23e-20	79.0	83	0.381	0.446	TIM8B_MOUSE Mitochondrial import inner membrane translocase subunit Tim8 B OS=Mus musculus OX=10090 GN=Timm8b PE=1 SV=1
6	Q9Y5J9	5.04e-20	78.6	83	0.381	0.446	TIM8B_HUMAN Mitochondrial import inner membrane translocase subunit Tim8 B OS=Homo sapiens OX=9606 GN=TIMM8B PE=1 SV=1
7	Q9Y1A3	1.54e-19	77.4	88	0.361	0.398	TIM8_DROME Mitochondrial import inner membrane translocase subunit Tim8 OS=Drosophila melanogaster OX=7227 GN=Tim8 PE=3 SV=1
8	Q09783	3.22e-15	67.0	98	0.320	0.316	TIM8_SCHPO Mitochondrial import inner membrane translocase subunit tim8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim8 PE=3 SV=1
9	Q9N408	3.21e-14	63.9	83	0.299	0.349	TIM8_CAEEL Mitochondrial import inner membrane translocase subunit Tim8 OS=Caenorhabditis elegans OX=6239 GN=ddp-1 PE=3 SV=1
10	P57744	1.76e-13	62.0	87	0.330	0.368	TIM8_YEAST Mitochondrial import inner membrane translocase subunit TIM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM8 PE=1 SV=1
11	Q9XGY4	1.01e-09	52.4	77	0.237	0.299	TIM8_ARATH Mitochondrial import inner membrane translocase subunit TIM8 OS=Arabidopsis thaliana OX=3702 GN=TIM8 PE=1 SV=1
12	Q9Y5L4	2.62e-07	46.6	95	0.206	0.211	TIM13_HUMAN Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1
13	P62075	3.32e-07	46.2	95	0.216	0.221	TIM13_MOUSE Mitochondrial import inner membrane translocase subunit Tim13 OS=Mus musculus OX=10090 GN=Timm13 PE=1 SV=1
14	P62076	3.32e-07	46.2	95	0.216	0.221	TIM13_RAT Mitochondrial import inner membrane translocase subunit Tim13 OS=Rattus norvegicus OX=10116 GN=Timm13 PE=3 SV=1
15	Q10481	6.25e-06	43.1	95	0.175	0.179	TIM13_SCHPO Mitochondrial import inner membrane translocase subunit tim13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim13 PE=3 SV=1
16	Q9XH48	2.49e-05	41.2	87	0.247	0.276	TIM13_ARATH Mitochondrial import inner membrane translocase subunit TIM13 OS=Arabidopsis thaliana OX=3702 GN=TIM13 PE=1 SV=2
17	K7EIT2	7.98e-05	39.7	80	0.144	0.175	K7EIT2_HUMAN Mitochondrial import inner membrane translocase subunit OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1
18	Q6FRT3	0.010	34.7	87	0.216	0.241	TIM9_CANGA Mitochondrial import inner membrane translocase subunit TIM9 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TIM9 PE=3 SV=1
19	P53299	0.022	33.9	105	0.186	0.171	TIM13_YEAST Mitochondrial import inner membrane translocase subunit TIM13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM13 PE=1 SV=1
20	O74700	0.045	32.7	87	0.206	0.230	TIM9_YEAST Mitochondrial import inner membrane translocase subunit TIM9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16026 MIEAP	1.2e+02	14.1	Mitochondria-eating protein
2	PF02953 zf-Tim10_DDP	1.1e-20	84.3	Tim10/DDP family zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008582897.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008579037.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
2	482537.XP_008588769.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
3	482537.XP_008587752.1	0.993	Mitochondrial import inner membrane translocase subunit Tim9
4	482537.XP_008568211.1	0.970	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 12 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008571906.1	0.967	Mitochondrial import inner membrane translocase subunit Tim10 B
6	482537.XP_008562701.1	0.874	Mitochondrial intermembrane space import and assembly protein 40
7	482537.XP_008565094.1	0.853	Mitochondrial import receptor subunit TOM22 homolog
8	482537.XP_008579883.1	0.820	FAD-linked sulfhydryl oxidase ALR
9	482537.XP_008572376.1	0.814	10 kDa heat shock protein, mitochondrial
10	482537.XP_008577000.1	0.805	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
11	482537.XP_008562411.1	0.789	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
12	482537.XP_008578411.1	0.769	Mitochondrial import receptor subunit TOM40B
13	482537.XP_008584229.1	0.769	Mitochondrial import receptor subunit TOM40 homolog
14	482537.XP_008591274.1	0.758	Mitochondrial import inner membrane translocase subunit Tim22
15	482537.XP_008564043.1	0.739	Calcium-binding mitochondrial carrier protein Aralar2
16	482537.XP_008574811.1	0.738	Calcium-binding mitochondrial carrier protein Aralar1 isoform X1
17	482537.XP_008572050.1	0.722	Coronin-7 isoform X1
18	482537.XP_008574469.1	0.720	Small nuclear ribonucleoprotein F-like
19	482537.XP_008575028.1	0.720	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 14 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
20	482537.XP_008567586.1	0.713	TP53-regulated inhibitor of apoptosis 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0046872	0.996	metal ion binding
GO:0008270	0.994	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006996	0.991	organelle organization
GO:0006626	0.975	protein targeting to mitochondrion
GO:0007007	0.872	inner mitochondrial membrane organization
GO:0051204	0.859	protein insertion into mitochondrial membrane
GO:0032501	0.350	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.971	membrane
GO:0031090	0.897	organelle membrane
GO:0031966	0.878	mitochondrial membrane
GO:0070013	0.876	intracellular organelle lumen
GO:0032991	0.807	protein-containing complex
GO:0005743	0.759	mitochondrial inner membrane
GO:0098798	0.526	mitochondrial protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]