StarFunc result for job id O60229

User Input

>input (1400 residues)
MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTF
PARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFP
AEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNH
EEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKA
PVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWH
VRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQYALDLQTQHNHFAMN
SMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVF
HQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLD
VLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCV
FQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEA
AEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDL
QKEMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSE
ARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIE
VTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIT
EVQASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVK
QVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQ
QKAEVLLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLE
SLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYI
HRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAK
QALDWIQETGEFYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVE
KGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDR
EVKLRDANHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPP
GILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKP
DSNQLILEHAGTFFDEIQQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4I9W4	0.379	0.329	0.000	1632	0.861	0.739	A0A0R4I9W4.pdb.gz
2	AFDB:A0A2R8RHL8	0.402	0.261	0.000	2306	0.776	0.471	A0A2R8RHL8.pdb.gz	A0A2R8RHL8_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=wu:fc60a10 PE=4 SV=1
3	AFDB:Q7KVD1	0.404	0.266	7.705E-81	2263	0.471	0.291	Q7KVD1.pdb.gz	Q7KVD1_DROME Trio, isoform A OS=Drosophila melanogaster OX=7227 GN=trio PE=1 SV=1
4	AFDB:O61528	0.394	0.238	2.431E-53	2488	0.261	0.147	O61528.pdb.gz	O61528_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-73 PE=1 SV=1
5	AFDB:A0A2R8QQW1	0.338	0.569	3.587E-53	775	0.407	0.735	A0A2R8QQW1.pdb.gz
6	AFDB:Q7SX85	0.211	0.356	1.862E-24	714	0.131	0.256	Q7SX85.pdb.gz	SESD1_DANRE SEC14 domain and spectrin repeat-containing protein 1 OS=Danio rerio OX=7955 GN=sestd1 PE=2 SV=3
7	AFDB:Q86VW0	0.225	0.391	2.542E-24	696	0.126	0.254	Q86VW0.pdb.gz	SESD1_HUMAN SEC14 domain and spectrin repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=SESTD1 PE=1 SV=2
8	AFDB:F1R446	0.184	0.119	8.552E-20	2480	0.139	0.078	F1R446.pdb.gz
9	AFDB:O15068	0.279	0.337	2.012E-19	1137	0.104	0.128	O15068.pdb.gz	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
10	AFDB:P02549	0.202	0.131	2.444E-19	2419	0.129	0.075	P02549.pdb.gz	SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTA1 PE=1 SV=5
11	PDB:1sjjA	0.148	0.222	1.617E-4	863	0.059	0.096	1sjjA.pdb.gz
12	PDB:4d1eA	0.130	0.193	1.131E-3	859	0.051	0.084	4d1eA.pdb.gz
13	PDB:6vaeA	0.056	0.064	1.271E-3	1198	0.114	0.134	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
14	PDB:4cizA	0.097	0.410	2.661E-3	284	0.026	0.130	4cizA.pdb.gz	Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.
15	PDB:3w68C	0.100	0.451	6.509E-3	252	0.021	0.119	3w68C.pdb.gz	Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
16	PDB:6f0eA	0.096	0.373	8.884E-3	300	0.018	0.083	6f0eA.pdb.gz	Target Identification and Mechanism of Action of Picolinamide and Benzamide Chemotypes with Antifungal Properties.
17	PDB:1oizA	0.099	0.439	1.311E-2	265	0.021	0.113	1oizA.pdb.gz	The Molecular Basis of Vitamin E Retention: Structure of Human Alpha-Tocopherol Transfer Protein
18	PDB:7qdrB	0.049	0.054	1.655E-2	1212	0.095	0.110	7qdrB.pdb.gz
19	PDB:7t3uC	0.060	0.056	1.860E-2	1575	0.131	0.117	7t3uC.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
20	PDB:6xu2A	0.046	0.055	2.260E-2	1091	0.094	0.120	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8RHL8	0.0	2238	2306	0.778	0.472	A0A2R8RHL8_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=wu:fc60a10 PE=4 SV=1
2	A2CG49	0.0	2801	2964	0.969	0.458	KALRN_MOUSE Kalirin OS=Mus musculus OX=10090 GN=Kalrn PE=1 SV=1
3	F1M0Z1	0.0	2235	3100	0.763	0.345	TRIO_RAT Triple functional domain protein OS=Rattus norvegicus OX=10116 GN=Trio PE=1 SV=4
4	H7BXZ5	0.0	2817	2955	0.977	0.463	H7BXZ5_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=1
5	O60229	0.0	2896	2986	1.000	0.469	KALRN_HUMAN Kalirin OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=3
6	O75962	0.0	2235	3097	0.762	0.345	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
7	P97924	0.0	2798	2959	0.969	0.458	KALRN_RAT Kalirin OS=Rattus norvegicus OX=10116 GN=Kalrn PE=1 SV=3
8	Q0KL02	0.0	2240	3102	0.765	0.345	TRIO_MOUSE Triple functional domain protein OS=Mus musculus OX=10090 GN=Trio PE=1 SV=3
9	Q7KVD1	0.0	1257	2263	0.476	0.294	Q7KVD1_DROME Trio, isoform A OS=Drosophila melanogaster OX=7227 GN=trio PE=1 SV=1
10	Q7KY09	0.0	1254	2263	0.475	0.294	Q7KY09_DROME Trio OS=Drosophila melanogaster OX=7227 GN=trio PE=2 SV=1
11	Q9W0L0	0.0	1256	2263	0.476	0.294	Q9W0L0_DROME Guanine-nucleotide-exchange-factor TRIO OS=Drosophila melanogaster OX=7227 GN=trio PE=2 SV=3
12	Q7KPP4	1.78e-153	508	1638	0.277	0.237	Q7KPP4_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-73 PE=1 SV=1
13	C4ALD5	1.87e-150	506	2140	0.277	0.181	C4ALD5_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-73 PE=1 SV=1
14	O61528	1.43e-149	506	2488	0.276	0.156	O61528_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-73 PE=1 SV=1
15	Q7SX85	3.04e-58	217	714	0.122	0.239	SESD1_DANRE SEC14 domain and spectrin repeat-containing protein 1 OS=Danio rerio OX=7955 GN=sestd1 PE=2 SV=3
16	Q86VW0	1.86e-57	214	696	0.124	0.250	SESD1_HUMAN SEC14 domain and spectrin repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=SESTD1 PE=1 SV=2
17	Q6PDM6	4.07e-37	155	1166	0.085	0.102	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
18	Q64096	4.38e-37	155	1149	0.085	0.104	MCF2L_MOUSE Guanine nucleotide exchange factor DBS OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=2
19	O15068	1.24e-36	153	1137	0.087	0.107	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
20	Q63406	3.18e-36	152	1149	0.085	0.104	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00650 CRAL_TRIO	0.0098	27.2	CRAL/TRIO domain
2	PF13716 CRAL_TRIO_2	7.5e-05	34.4	Divergent CRAL/TRIO domain
3	PF20292 MC7	5.1e+02	12.1	ABC-three component (ABC-3C) system Middle Component 7
4	PF00621 RhoGEF	2.5e-16	71.9	RhoGEF domain
5	PF00435 Spectrin	1.8e-36	136.1	Spectrin repeat
6	PF18043 T4_Rnl2_C	1e+02	14.6	T4 RNA ligase 2 C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000004008

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000011176	0.894	Ras homolog family member A
2	60711.ENSCSAP00000000601	0.886	Ras homolog family member G
3	60711.ENSCSAP00000017098	0.880	Uncharacterized protein
4	60711.ENSCSAP00000016423	0.869	Ras homolog family member C
5	60711.ENSCSAP00000017620	0.863	Ras homolog family member B
6	60711.ENSCSAP00000003785	0.855	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
7	60711.ENSCSAP00000015866	0.855	Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
8	60711.ENSCSAP00000013736	0.851	Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
9	60711.ENSCSAP00000014118	0.840	DCC netrin 1 receptor
10	60711.ENSCSAP00000018916	0.835	ADP-ribosylation factor 6
11	60711.ENSCSAP00000004704	0.826	Ras homolog family member D
12	60711.ENSCSAP00000008237	0.820	Discs, large homolog 4 (Drosophila)
13	60711.ENSCSAP00000006864	0.818	Ras homolog family member U
14	60711.ENSCSAP00000010157	0.818	Ras homolog family member J
15	60711.ENSCSAP00000009665	0.814	Ras homolog family member Q
16	60711.ENSCSAP00000003864	0.813	Ras homolog family member V
17	60711.ENSCSAP00000010098	0.812	Neogenin 1
18	60711.ENSCSAP00000015846	0.812	Ras homolog family member F (in filopodia)
19	60711.ENSCSAP00000019186	0.800	Ras homolog family member H
20	60711.ENSCSAP00000002532	0.797	Rho family GTPase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0019899	0.460	enzyme binding
GO:0003824	0.395	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0065007	0.927	biological regulation
GO:0050789	0.920	regulation of biological process
GO:0050794	0.903	regulation of cellular process
GO:0048856	0.735	anatomical structure development
GO:0050896	0.637	response to stimulus
GO:0007154	0.487	cell communication
GO:0023052	0.472	signaling
GO:0051716	0.426	cellular response to stimulus
GO:0023051	0.398	regulation of signaling
GO:0010646	0.398	regulation of cell communication
GO:0048583	0.397	regulation of response to stimulus
GO:0009966	0.377	regulation of signal transduction
GO:0007165	0.348	signal transduction
GO:0030154	0.322	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.994	cytosol
GO:0030054	0.989	cell junction
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0005634	0.961	nucleus
GO:0043228	0.917	non-membrane-bounded organelle
GO:0043232	0.911	intracellular non-membrane-bounded organelle
GO:0031974	0.881	membrane-enclosed lumen
GO:0005654	0.870	nucleoplasm
GO:0005576	0.845	extracellular region
GO:0045202	0.836	synapse
GO:0031982	0.791	vesicle
GO:0016020	0.782	membrane
GO:0071944	0.689	cell periphery
GO:0005886	0.682	plasma membrane
GO:0098978	0.666	glutamatergic synapse
GO:0005856	0.658	cytoskeleton
GO:0042995	0.405	cell projection
GO:0043005	0.395	neuron projection
GO:0098794	0.313	postsynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]