StarFunc result for job id O60231

User Input

>input (1041 residues)
MATPAGLERWVQDELHSVLGLSERHVAQFLIGTAQRCTSAEEFVQRLRDTDTLDLSGPAR
DFALRLWNKVPRKAVVEKPARAAEREARALLEKNRSYRLLEDSEESSEETVSRAGSSLQK
KRKKRKHLRKKREEEEEEEASEKGKKKTGGSKQQTEKPESEDEWERTERERLQDLEERDA
FAERVRQRDKDRTRNVLERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKRER
EKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEKLEATNRYHM
PKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEE
ETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLII
EGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYS
IRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVA
RFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVL
QIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIF
QPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASAN
QRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDF
LDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEI
LTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYE
NFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYR
TVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKE
LEDPHAKKMPKKIGKTREELG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QU72	0.796	0.786	0.000	1054	0.738	0.729	F1QU72.pdb.gz
2	AFDB:F4IJV4	0.681	0.679	0.000	1044	0.528	0.527	F4IJV4.pdb.gz	DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana OX=3702 GN=MEE29 PE=2 SV=1
3	AFDB:O45244	0.707	0.729	0.000	1008	0.551	0.569	O45244.pdb.gz	DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans OX=6239 GN=mog-4 PE=1 SV=2
4	AFDB:O60231	1.000	1.000	0.000	1041	1.000	1.000	O60231.pdb.gz	DHX16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens OX=9606 GN=DHX16 PE=1 SV=2
5	AFDB:Q10752	0.720	0.711	0.000	1055	0.496	0.489	Q10752.pdb.gz	CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc28 PE=3 SV=2
6	AFDB:Q8VY00	0.713	0.711	0.000	1044	0.549	0.547	Q8VY00.pdb.gz	ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana OX=3702 GN=ESP3 PE=1 SV=1
7	AFDB:Q9VIZ3	0.692	0.803	0.000	894	0.563	0.655	Q9VIZ3.pdb.gz	Q9VIZ3_DROME LD25692p OS=Drosophila melanogaster OX=7227 GN=l(2)37Cb PE=1 SV=1
8	PDB:6ff7q	0.579	0.950	4.157E-92	625	0.600	1.000	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
9	AFDB:Q14562	0.595	0.509	2.436E-82	1220	0.407	0.348	Q14562.pdb.gz	DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1
10	AFDB:A0A286Y8Y8	0.596	0.503	9.227E-82	1238	0.424	0.356	A0A286Y8Y8.pdb.gz
11	AFDB:Q38953	0.601	0.537	1.076E-81	1168	0.426	0.379	Q38953.pdb.gz	DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana OX=3702 GN=At3g26560 PE=1 SV=2
12	PDB:7dvqx	0.546	0.934	1.534E-80	599	0.572	0.993	7dvqx.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:5xjcY	0.584	0.845	5.612E-73	713	0.359	0.525	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
14	PDB:5ylzW	0.583	0.853	3.760E-69	703	0.331	0.491	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
15	PDB:6id1V	0.586	0.912	7.720E-68	663	0.324	0.508	6id1V.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
16	PDB:3kx2B	0.582	0.794	3.778E-67	755	0.310	0.428	3kx2B.pdb.gz	Structural basis for the function of DEAH helicases
17	PDB:7dcpx	0.572	0.876	5.691E-67	670	0.307	0.478	7dcpx.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
18	PDB:5yzgZ	0.539	0.862	4.691E-62	635	0.306	0.502	5yzgZ.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:5wsge	0.559	0.835	6.378E-62	679	0.286	0.439	5wsge.pdb.gz	Structure of a yeast step II catalytically activated spliceosome
20	PDB:5gm6Y	0.548	0.941	2.561E-58	598	0.302	0.525	5gm6Y.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A1Z9L3	799	1242	0.349	0.292	DHX8_DROME ATP-dependent RNA helicase DHX8 OS=Drosophila melanogaster OX=7227 GN=pea PE=1 SV=1
2	A2ACQ1	620	703	0.299	0.442	A2ACQ1_MOUSE RNA helicase OS=Mus musculus OX=10090 GN=Dhx35 PE=1 SV=1
3	D3ZD97	681	795	0.328	0.429	D3ZD97_RAT RNA helicase OS=Rattus norvegicus OX=10116 GN=Dhx15 PE=3 SV=1
4	D6XG53	583	735	0.287	0.407	D6XG53_TRYB2 Pre-mRNA splicing factor ATP-dependent RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.30H13.60 PE=4 SV=1
5	F4IE66	573	717	0.284	0.413	PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana OX=3702 GN=RID1 PE=1 SV=1
6	F4IJV4	1098	1044	0.535	0.534	DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana OX=3702 GN=MEE29 PE=2 SV=1
7	F4JRJ6	623	695	0.296	0.443	DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana OX=3702 GN=At4g18465 PE=3 SV=1
8	F4K2E9	715	1255	0.335	0.278	PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana OX=3702 GN=CUV PE=1 SV=1
9	F5H658	761	1181	0.334	0.295	F5H658_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1
10	O22899	704	729	0.330	0.472	PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana OX=3702 GN=At2g47250 PE=2 SV=1
11	O35286	680	795	0.328	0.429	DHX15_MOUSE ATP-dependent RNA helicase DHX15 OS=Mus musculus OX=10090 GN=Dhx15 PE=1 SV=2
12	O42643	736	1168	0.364	0.324	PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp22 PE=1 SV=1
13	O42945	655	735	0.323	0.457	DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp43 PE=3 SV=1
14	O43143	680	795	0.328	0.429	DHX15_HUMAN ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2
15	O45244	1177	1008	0.554	0.572	DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans OX=6239 GN=mog-4 PE=1 SV=2
16	O60231	2137	1041	1.000	1.000	DHX16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens OX=9606 GN=DHX16 PE=1 SV=2
17	P15938	589	1071	0.297	0.289	PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP16 PE=1 SV=2
18	P20095	646	876	0.331	0.394	PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP2 PE=1 SV=1
19	P24384	753	1145	0.329	0.300	PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP22 PE=1 SV=1
20	P34498	700	1131	0.312	0.287	MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans OX=6239 GN=mog-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13245 AAA_19	49	15.6	AAA domain
2	PF13401 AAA_22	4.6	19.0	AAA domain
3	PF13604 AAA_30	0.17	23.1	AAA domain
4	PF00270 DEAD	0.0015	29.8	DEAD/DEAH box helicase
5	PF20404 DUF6694	4.6e+02	12.6	Family of unknown function (DUF6694)
6	PF07652 Flavi_DEAD	1.6e+02	13.7	Flavivirus DEAD domain
7	PF04408 HA2	7.1e-16	69.7	Helicase associated domain (HA2)
8	PF00271 Helicase_C	2e-08	46.0	Helicase conserved C-terminal domain
9	PF07717 OB_NTP_bind	2e-16	71.4	Oligonucleotide/oligosaccharide-binding (OB)-fold
10	PF07517 SecA_DEAD	56	14.5	SecA DEAD-like domain
11	PF00448 SRP54	1.3e+02	13.6	SRP54-type protein, GTPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365625

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317123	0.999	U5 small nuclear ribonucleoprotein 200 kDa helicase
2	9606.ENSP00000318861	0.999	Splicing factor 3B subunit 2
3	9606.ENSP00000335321	0.999	Splicing factor 3B subunit 1
4	9606.ENSP00000387006	0.999	Pre-mRNA-splicing factor CWC22 homolog
5	9606.ENSP00000392094	0.999	116 kDa U5 small nuclear ribonucleoprotein component
6	9606.ENSP00000460348	0.999	Pre-mRNA-processing-splicing factor 8
7	9606.ENSP00000221494	0.998	Splicing factor 3A subunit 2
8	9606.ENSP00000260210	0.998	BUD13 homolog
9	9606.ENSP00000305790	0.998	Splicing factor 3B subunit 3
10	9606.ENSP00000339090	0.998	RNA binding motif protein, X-linked 2
11	9606.ENSP00000360497	0.998	RING finger protein 113A
12	9606.ENSP00000370460	0.998	Peptidyl-prolyl cis-trans isomerase CWC27 homolog
13	9606.ENSP00000271628	0.997	Splicing factor 3B subunit 4
14	9606.ENSP00000351137	0.997	Pre-mRNA-splicing factor SYF1
15	9606.ENSP00000356541	0.997	Splicing factor 3B subunit 5
16	9606.ENSP00000360532	0.997	Cell division cycle 5-like protein
17	9606.ENSP00000215793	0.996	Splicing factor 3A subunit 1
18	9606.ENSP00000216252	0.996	PHD finger-like domain-containing protein 5A
19	9606.ENSP00000296215	0.996	Smad nuclear-interacting protein 1
20	9606.ENSP00000301740	0.996	Serine/arginine repetitive matrix protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003724	1.000	RNA helicase activity
GO:0016887	0.990	ATP hydrolysis activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0008380	0.988	RNA splicing
GO:0000377	0.963	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0000398	0.950	mRNA splicing, via spliceosome
GO:0050789	0.418	regulation of biological process
GO:0050794	0.371	regulation of cellular process
GO:0019222	0.300	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.979	protein-containing complex
GO:0140513	0.880	nuclear protein-containing complex
GO:0005681	0.866	spliceosomal complex
GO:0071005	0.846	U2-type precatalytic spliceosome
GO:0071013	0.516	catalytic step 2 spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	1.000	RNA helicase.
RHEA:13065	0.990	ATP + H2O = ADP + H(+) + phosphate

[back to server]