StarFunc result for job id O60237

User Input

>input (982 residues)
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGA
VFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEL
LQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSS
SSEEEEGEDEASESETEKEADKKPEAFVNHSNSESKSSITEQIPAPAQNTFSASSARRFS
SGLFNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPIRDRGSSIYRSSSSPRISAL
LDNKDKERENKSYISSLAPRKLNSTSDIEEKENRESAVNLVRSGSYTRQLWRDEAKGNEI
PQTIAPSTYVSTYLKRTPHKSQADTTAEKTADNVSSSTPLCVITNRPLPSTANGVTATPV
LSITGTDSSVEAREKRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAERT
FSRSRAERQAQEQPREKPTDTEGLEGSPEKHEPSAVPATEAGEGQQPWGRSLDEEPICHR
LRCPAQPDKPTTPASPSTSRPSLYTSSHLLWTNRFSVPDSESSETTTNTTTAKEMDKNEN
EEADLDEQSSKRLSIRERRRPKERRRGTGINFWTKDEDETDGSEEVKETWHERLSRLESG
GSNPTTSDSYGDRASARARREAREARLATLTSRVEEDSNRDYKKLYESALTENQKLKTKL
QEAQLELADIKSKLEKVAQQKQEKTSDRSSVLEMEKRERRALERKMSEMEEEMKVLTELK
SDNQRLKDENGALIRVISKLSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60237	1.000	1.000	0.000	982	1.000	1.000	O60237.pdb.gz	MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=2
2	AFDB:Q10728	0.312	0.299	3.784E-52	1032	0.470	0.448	Q10728.pdb.gz	MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus OX=10116 GN=Ppp1r12a PE=1 SV=2
3	AFDB:Q6DRG7	0.356	0.335	2.813E-51	1049	0.474	0.443	Q6DRG7.pdb.gz	MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio OX=7955 GN=ppp1r12a PE=2 SV=2
4	AFDB:Q90623	0.322	0.315	2.781E-47	1004	0.442	0.432	Q90623.pdb.gz	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1
5	AFDB:G5ECD7	0.311	0.274	1.045E-30	1124	0.288	0.252	G5ECD7.pdb.gz	G5ECD7_CAEEL cGMP-dependent protein kinase interacting domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
6	AFDB:M9NEB2	0.296	0.233	1.881E-30	1273	0.255	0.196	M9NEB2.pdb.gz	M9NEB2_DROME Myosin binding subunit, isoform O OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
7	AFDB:Q8IQN4	0.304	0.264	2.402E-30	1144	0.337	0.289	Q8IQN4.pdb.gz	Q8IQN4_DROME FI18194p1 OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=2
8	AFDB:M9NDA1	0.286	0.230	2.062E-28	1230	0.270	0.215	M9NDA1.pdb.gz	M9NDA1_DROME Myosin binding subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
9	PDB:2dvwA	0.118	0.479	1.347E-12	229	0.076	0.328	2dvwA.pdb.gz
10	PDB:8cs9A	0.119	0.146	1.104E-11	796	0.073	0.090	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
11	AFDB:A0A0G2K916	0.122	0.054	1.324E-10	2615	0.148	0.055	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
12	PDB:1wg0A	0.119	0.428	2.789E-10	243	0.055	0.222	1wg0A.pdb.gz
13	PDB:4oauC	0.119	0.161	5.534E-10	692	0.069	0.098	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	AFDB:Q8WXD9	0.136	0.097	9.375E-10	1431	0.153	0.105	Q8WXD9.pdb.gz	CSKI1_HUMAN Caskin-1 OS=Homo sapiens OX=9606 GN=CASKIN1 PE=1 SV=1
15	PDB:6v9hC	0.116	0.392	5.518E-9	270	0.055	0.200	6v9hC.pdb.gz
16	PDB:5vkqA	0.114	0.085	9.926E-9	1499	0.065	0.043	5vkqA.pdb.gz
17	PDB:6jd6B	0.103	0.447	2.068E-8	192	0.048	0.245	6jd6B.pdb.gz
18	PDB:6mwqA	0.097	0.190	2.068E-8	493	0.059	0.118	6mwqA.pdb.gz
19	PDB:6aunA	0.109	0.170	1.775E-6	618	0.059	0.094	6aunA.pdb.gz
20	PDB:1bd8A	0.088	0.468	1.864E-6	156	0.051	0.321	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60237	0.0	2003	982	1.000	1.000	MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=2
2	Q8BG95	0.0	1602	976	0.897	0.903	MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus OX=10090 GN=Ppp1r12b PE=1 SV=2
3	Q9DBR7	0.0	681	1029	0.515	0.492	MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus OX=10090 GN=Ppp1r12a PE=1 SV=2
4	Q90623	8.11e-180	550	1004	0.375	0.367	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1
5	Q10728	1.87e-171	530	1032	0.312	0.297	MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus OX=10116 GN=Ppp1r12a PE=1 SV=2
6	F8VZN8	7.79e-171	517	692	0.308	0.436	F8VZN8_HUMAN Protein phosphatase 1 regulatory subunit 12A (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1
7	E1BC59	1.21e-170	527	1028	0.309	0.295	E1BC59_BOVIN Protein phosphatase 1 regulatory subunit OS=Bos taurus OX=9913 GN=PPP1R12A PE=4 SV=3
8	O14974	1.54e-167	519	1030	0.308	0.293	MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1
9	Q6DRG7	1.80e-161	504	1049	0.314	0.294	MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio OX=7955 GN=ppp1r12a PE=2 SV=2
10	A0A0S2Z4Q8	1.43e-126	382	184	0.184	0.984	A0A0S2Z4Q8_HUMAN Protein phosphatase 1 regulatory subunit 12B isoform 2 OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=1
11	M9NFZ0	5.02e-99	317	341	0.168	0.484	M9NFZ0_DROME Myosin binding subunit, isoform P OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
12	A8JNT5	5.82e-97	325	795	0.168	0.208	A8JNT5_DROME Myosin binding subunit, isoform G OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
13	Q86R99	6.09e-97	325	797	0.168	0.207	Q86R99_DROME Myosin phosphatase DMBS-S OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
14	Q9VUX6	7.16e-97	327	860	0.168	0.192	Q9VUX6_DROME Myosin binding subunit, isoform K OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=3
15	M9PCQ3	7.09e-96	329	1111	0.168	0.149	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
16	Q8MT32	8.31e-96	330	1144	0.168	0.144	Q8MT32_DROME RE63915p OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
17	Q8IQN4	9.27e-96	330	1144	0.168	0.144	Q8IQN4_DROME FI18194p1 OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=2
18	Q8MV37	1.01e-95	329	1101	0.168	0.150	Q8MV37_DROME Myosin binding subunit of myosin phosphatase OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
19	A8JNT4	1.47e-95	325	925	0.164	0.174	A8JNT4_DROME Myosin binding subunit, isoform H OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
20	Q86RA0	1.63e-95	325	927	0.164	0.174	Q86RA0_DROME Myosin phosphatase DMBS-L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.5e-21	85.9	Ankyrin repeat
2	PF12796 Ank_2	6.8e-31	118.0	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	4.2e-20	80.5	Ankyrin repeat
4	PF13637 Ank_4	3e-31	118.6	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2.9e-27	105.6	Ankyrin repeats (many copies)
6	PF14417 MEDS	7.2e+02	11.4	MEDS: MEthanogen/methylotroph, DcmR Sensory domain
7	PF15898 PRKG1_interact	7.5e-34	127.9	cGMP-dependent protein kinase interacting domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000476755

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378769	0.987	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
2	9606.ENSP00000400175	0.977	Transforming protein RhoA
3	9606.ENSP00000341779	0.962	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
4	9606.ENSP00000470298	0.962	Myosin-14
5	9606.ENSP00000279022	0.955	Myosin regulatory light polypeptide 9
6	9606.ENSP00000382697	0.954	Rho-associated protein kinase 1
7	9606.ENSP00000379616	0.949	Myosin-11
8	9606.ENSP00000317985	0.948	Rho-associated protein kinase 2
9	9606.ENSP00000301242	0.944	Protein phosphatase 1 regulatory subunit 14A
10	9606.ENSP00000463559	0.944	Myosin regulatory light chain 12B
11	9606.ENSP00000216181	0.941	Myosin-9
12	9606.ENSP00000285735	0.935	Rho-related GTP-binding protein RhoC
13	9606.ENSP00000228841	0.933	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
14	9606.ENSP00000272233	0.930	Rho-related GTP-binding protein RhoB
15	9606.ENSP00000353590	0.928	Myosin-10
16	9606.ENSP00000446955	0.925	Myosin light polypeptide 6
17	9606.ENSP00000278568	0.918	Serine/threonine-protein kinase PAK 1
18	9606.ENSP00000300093	0.907	Serine/threonine-protein kinase PLK1
19	9606.ENSP00000310375	0.900	Membrane protein MLC1
20	9606.ENSP00000326031	0.887	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008047	1.000	enzyme activator activity
GO:0003824	0.392	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.991	cellular process
GO:0050789	0.991	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0050896	0.958	response to stimulus
GO:0051716	0.912	cellular response to stimulus
GO:0051239	0.811	regulation of multicellular organismal process
GO:0007154	0.785	cell communication
GO:0023052	0.778	signaling
GO:0090257	0.701	regulation of muscle system process
GO:0007165	0.630	signal transduction
GO:0006937	0.436	regulation of muscle contraction
GO:0008152	0.380	metabolic process
GO:0044237	0.339	cellular metabolic process
GO:0071704	0.323	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005829	0.996	cytosol
GO:0005654	0.993	nucleoplasm
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0099512	0.913	supramolecular fiber
GO:0043292	0.701	contractile fiber
GO:0016020	0.508	membrane
GO:0071944	0.443	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]