StarFunc result for job id O60238

User Input

>input (219 residues)
MSSHLVEPPPPLHNNNNNCEENEQSLPPPAGLNSSWVELPMNSSNGNDNGNGKNGGLEHV
PSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQS
EEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMKKGGI
FSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60238	1.000	1.000	8.984E-34	219	1.000	1.000	O60238.pdb.gz	BNI3L_HUMAN BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like OS=Homo sapiens OX=9606 GN=BNIP3L PE=1 SV=1
2	AFDB:A2BG79	0.245	0.252	5.512E-17	213	0.566	0.582	A2BG79.pdb.gz
3	AFDB:Q12983	0.240	0.206	1.525E-14	259	0.489	0.413	Q12983.pdb.gz	BNIP3_HUMAN BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 OS=Homo sapiens OX=9606 GN=BNIP3 PE=1 SV=4
4	AFDB:Q9BL91	0.146	0.094	9.384E-2	369	0.164	0.098	Q9BL91.pdb.gz	Q9BL91_CAEEL Uncharacterized protein OS=Caenorhabditis elegans OX=6239 GN=rec-1 PE=4 SV=3
5	AFDB:P20095	0.176	0.050	2.340E-1	876	0.105	0.026	P20095.pdb.gz	PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP2 PE=1 SV=1
6	AFDB:A7SXY9	0.133	0.086	4.405E-1	367	0.151	0.090	A7SXY9.pdb.gz	A7SXY9_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g248021 PE=1 SV=1
7	AFDB:Q3LGD4	0.155	0.065	4.405E-1	621	0.137	0.048	Q3LGD4.pdb.gz	RFP4A_DANRE Rab11 family-interacting protein 4A OS=Danio rerio OX=7955 GN=rab11fip4a PE=2 SV=1
8	AFDB:Q5XJ95	0.150	0.112	5.069E-1	305	0.114	0.082	Q5XJ95.pdb.gz	Q5XJ95_DANRE PRKC apoptosis WT1 regulator protein OS=Danio rerio OX=7955 GN=pawrl PE=2 SV=1
9	AFDB:Q8IL26	0.136	0.027	8.291E-1	1558	0.119	0.017	Q8IL26.pdb.gz	EIK1_PLAF7 Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=eIK1 PE=1 SV=1
10	AFDB:Q9CAD0	0.089	0.040	8.291E-1	596	0.178	0.065	Q9CAD0.pdb.gz	EGL1_ARATH Transcription factor EGL1 OS=Arabidopsis thaliana OX=3702 GN=BHLH2 PE=1 SV=1
11	PDB:2ndjA	0.121	0.241	5.815	103	0.068	0.146	2ndjA.pdb.gz
12	PDB:5nrlG	0.124	0.079	8.865	372	0.087	0.051	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
13	PDB:5weoA	0.124	0.029	9.510	988	0.050	0.011	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60238	1.39e-160	444	219	1.000	1.000	BNI3L_HUMAN BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like OS=Homo sapiens OX=9606 GN=BNIP3L PE=1 SV=1
2	Q6IBV1	1.39e-160	444	219	1.000	1.000	Q6IBV1_HUMAN BCL2/adenovirus E1B 19kDa interacting protein 3-like OS=Homo sapiens OX=9606 GN=BNIP3L PE=2 SV=1
3	Q9Z2F7	9.61e-156	432	218	0.968	0.972	BNI3L_MOUSE BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like OS=Mus musculus OX=10090 GN=Bnip3l PE=1 SV=1
4	Q8VBW4	1.07e-155	431	218	0.968	0.972	Q8VBW4_RAT BNIP3L protein OS=Rattus norvegicus OX=10116 GN=Bnip3l PE=2 SV=1
5	A0A8I6ACG8	1.75e-141	395	204	0.895	0.961	A0A8I6ACG8_RAT BCL2 interacting protein 3 like OS=Rattus norvegicus OX=10116 GN=Bnip3l PE=3 SV=1
6	H0YBC7	1.75e-130	367	185	0.831	0.984	H0YBC7_HUMAN BCL2 interacting protein 3 like (Fragment) OS=Homo sapiens OX=9606 GN=BNIP3L PE=1 SV=1
7	A0A8I6AKI3	4.06e-130	366	200	0.836	0.915	A0A8I6AKI3_RAT BCL2 interacting protein 3 like OS=Rattus norvegicus OX=10116 GN=Bnip3l PE=1 SV=1
8	A0A8I6AG85	3.02e-129	365	240	0.836	0.762	A0A8I6AG85_RAT BCL2 interacting protein 3 like OS=Rattus norvegicus OX=10116 GN=Bnip3l PE=1 SV=1
9	Q66HQ4	9.70e-129	365	271	0.822	0.664	Q66HQ4_RAT Bnip3l protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Bnip3l PE=2 SV=1
10	Q58EQ7	1.29e-77	234	213	0.584	0.601	Q58EQ7_DANRE BCL2 interacting protein 3 like b OS=Danio rerio OX=7955 GN=bnip3l PE=2 SV=1
11	Q12983	1.84e-57	182	194	0.539	0.608	BNIP3_HUMAN BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 OS=Homo sapiens OX=9606 GN=BNIP3 PE=1 SV=4
12	Q9ET45	3.54e-56	178	187	0.521	0.610	Q9ET45_RAT BCL2 interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Bnip3 PE=1 SV=1
13	O55003	6.04e-56	178	187	0.525	0.615	BNIP3_MOUSE BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 OS=Mus musculus OX=10090 GN=Bnip3 PE=1 SV=1
14	A0A8I6AQ99	7.00e-49	159	173	0.475	0.601	A0A8I6AQ99_RAT BCL2 interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Bnip3 PE=1 SV=1
15	M9VYP0	4.60e-09	53.5	75	0.174	0.507	M9VYP0_RAT BCL2 interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Bnip3 PE=2 SV=1
16	Q09969	7.63e-04	41.6	221	0.100	0.100	BNIP3_CAEEL NIP3 homolog OS=Caenorhabditis elegans OX=6239 GN=dct-1 PE=1 SV=2
17	Q9VPD6	0.74	32.7	201	0.178	0.194	Q9VPD6_DROME BNIP3, isoform A OS=Drosophila melanogaster OX=7227 GN=BNIP3 PE=1 SV=1
18	Q8IPU7	0.87	32.3	177	0.178	0.220	Q8IPU7_DROME BNIP3, isoform C OS=Drosophila melanogaster OX=7227 GN=BNIP3 PE=2 SV=1
19	Q8IPU8	0.98	32.0	193	0.178	0.202	Q8IPU8_DROME BNIP3, isoform B OS=Drosophila melanogaster OX=7227 GN=BNIP3 PE=3 SV=1
20	Q69ZN7	6.3	30.4	2048	0.059	0.006	MYOF_MOUSE Myoferlin OS=Mus musculus OX=10090 GN=Myof PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06553 BNIP3	3.1e-68	240.6	BNIP3
2	PF11782 DUF3319	54	15.2	Protein of unknown function (DUF3319)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370003

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306866	0.998	Gamma-aminobutyric acid receptor-associated protein
2	9606.ENSP00000262187	0.986	GTP-binding protein Rheb
3	9606.ENSP00000037243	0.980	Gamma-aminobutyric acid receptor-associated protein-like 2
4	9606.ENSP00000266458	0.974	Gamma-aminobutyric acid receptor-associated protein-like 1
5	9606.ENSP00000302564	0.968	Bcl-2-like protein 1
6	9606.ENSP00000376822	0.963	Metalloreductase STEAP3
7	9606.ENSP00000268607	0.943	Microtubule-associated proteins 1A/1B light chain 3B
8	9606.ENSP00000269305	0.943	Cellular tumor antigen p53
9	9606.ENSP00000262367	0.905	CREB-binding protein
10	9606.ENSP00000357625	0.883	BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
11	9606.ENSP00000367284	0.867	FUN14 domain-containing protein 1
12	9606.ENSP00000363970	0.847	Microtubule-associated proteins 1A/1B light chain 3A
13	9606.ENSP00000329507	0.841	CMRF35-like molecule 6
14	9606.ENSP00000355231	0.835	Beclin-1
15	9606.ENSP00000262300	0.819	Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase
16	9606.ENSP00000364204	0.808	Serine/threonine-protein kinase PINK1, mitochondrial
17	9606.ENSP00000284637	0.806	E3 ubiquitin-protein ligase SH3RF1
18	9606.ENSP00000295213	0.787	Mitochondria-eating protein
19	9606.ENSP00000374455	0.763	Sequestosome-1
20	9606.ENSP00000411250	0.750	Next to BRCA1 gene 1 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.998	identical protein binding
GO:0046983	0.795	protein dimerization activity
GO:0042803	0.742	protein homodimerization activity
GO:0005521	0.556	lamin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0048522	0.991	positive regulation of cellular process
GO:0006839	0.985	mitochondrial transport
GO:0043065	0.984	positive regulation of apoptotic process
GO:0042391	0.976	regulation of membrane potential
GO:0007006	0.967	mitochondrial membrane organization
GO:0046902	0.958	regulation of mitochondrial membrane permeability
GO:0051881	0.950	regulation of mitochondrial membrane potential
GO:0050896	0.814	response to stimulus
GO:0008152	0.812	metabolic process
GO:0019222	0.800	regulation of metabolic process
GO:0031323	0.761	regulation of cellular metabolic process
GO:0051716	0.691	cellular response to stimulus
GO:0071704	0.679	organic substance metabolic process
GO:0009894	0.674	regulation of catabolic process
GO:0006950	0.658	response to stress
GO:0044238	0.637	primary metabolic process
GO:0009893	0.636	positive regulation of metabolic process
GO:0048519	0.606	negative regulation of biological process
GO:0043170	0.606	macromolecule metabolic process
GO:0006807	0.596	nitrogen compound metabolic process
GO:0009056	0.591	catabolic process
GO:1901564	0.591	organonitrogen compound metabolic process
GO:0048523	0.582	negative regulation of cellular process
GO:0031329	0.579	regulation of cellular catabolic process
GO:0019538	0.553	protein metabolic process
GO:0010506	0.544	regulation of autophagy
GO:0044237	0.463	cellular metabolic process
GO:0033554	0.461	cellular response to stress
GO:0031325	0.460	positive regulation of cellular metabolic process
GO:0042221	0.419	response to chemical
GO:0051128	0.407	regulation of cellular component organization
GO:0070887	0.318	cellular response to chemical stimulus
GO:0009605	0.315	response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005739	0.993	mitochondrion
GO:0005829	0.979	cytosol
GO:0031090	0.882	organelle membrane
GO:0005634	0.790	nucleus
GO:0005654	0.779	nucleoplasm
GO:0016604	0.387	nuclear body
GO:0005783	0.380	endoplasmic reticulum
GO:0005635	0.373	nuclear envelope
GO:0016607	0.365	nuclear speck
GO:0005741	0.356	mitochondrial outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]