StarFunc result for job id O60239

User Input

>input (455 residues)
MDAALKRSRSEEPAEILPPARDEEEEEEEGMEQGLEEEEEVDPRIQGELEKLNQSTDDIN
RRETELEDARQKFRSVLVEATVKLDELVKKIGKAVEDSKPYWEARRVARQAQLEAQKATQ
DFQRATEVLRAAKETISLAEQRLLEDDKRQFDSAWQEMLNHATQRVMEAEQTKTRSELVH
KETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKAKYYVQLEQLKKTVDDLQAKLTLAK
GEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPDAISVASE
AFEDDSCSNFVSEDDSETQSVSSFSSGPTSPSEMPDQFPAVVRPGSLDLPSPVSLSEFGM
MFPVLGPRSECSGASSPECEVERGDRAEGAENKTSDKANNNRGLSSSSGSGGSSKSQSST
SPEGQALENRMKQLSLQCSKGRDGIIADIKMVQIG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z131	0.571	0.562	1.449E-46	463	0.892	0.877	Q9Z131.pdb.gz	3BP5_MOUSE SH3 domain-binding protein 5 OS=Mus musculus OX=10090 GN=Sh3bp5 PE=1 SV=3
2	AFDB:Q9V785	0.486	0.464	4.482E-18	477	0.323	0.308	Q9V785.pdb.gz	3BP5H_DROME SH3 domain-binding protein 5 homolog OS=Drosophila melanogaster OX=7227 GN=pcs PE=1 SV=4
3	AFDB:Q7L8J4	0.501	0.577	1.592E-17	393	0.284	0.328	Q7L8J4.pdb.gz	3BP5L_HUMAN SH3 domain-binding protein 5-like OS=Homo sapiens OX=9606 GN=SH3BP5L PE=1 SV=1
4	AFDB:Q9ZTZ7	0.221	0.092	3.453E-8	1193	0.121	0.046	Q9ZTZ7.pdb.gz	KEA1_ARATH K(+) efflux antiporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KEA1 PE=1 SV=2
5	AFDB:P42171	0.449	0.803	7.626E-8	244	0.119	0.221	P42171.pdb.gz	REI1_CAEEL Guanine nucleotide exchange factor rei-1 OS=Caenorhabditis elegans OX=6239 GN=rei-1 PE=1 SV=1
6	AFDB:Q52LW3	0.165	0.075	4.006E-6	1261	0.134	0.048	Q52LW3.pdb.gz	RHG29_HUMAN Rho GTPase-activating protein 29 OS=Homo sapiens OX=9606 GN=ARHGAP29 PE=1 SV=2
7	AFDB:Q9TXS0	0.160	0.092	4.006E-6	968	0.134	0.063	Q9TXS0.pdb.gz	Q9TXS0_CAEEL FCH domain only protein 2 OS=Caenorhabditis elegans OX=6239 GN=fcho-1 PE=1 SV=1
8	AFDB:Q8CGF1	0.171	0.077	6.113E-6	1266	0.132	0.047	Q8CGF1.pdb.gz	RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus OX=10090 GN=Arhgap29 PE=1 SV=1
9	AFDB:Q8IUG5	0.184	0.038	9.328E-6	2567	0.160	0.028	Q8IUG5.pdb.gz	MY18B_HUMAN Unconventional myosin-XVIIIb OS=Homo sapiens OX=9606 GN=MYO18B PE=1 SV=2
10	AFDB:Q6NSJ2	0.134	0.101	1.668E-5	640	0.182	0.130	Q6NSJ2.pdb.gz	PHLB3_HUMAN Pleckstrin homology-like domain family B member 3 OS=Homo sapiens OX=9606 GN=PHLDB3 PE=1 SV=3
11	PDB:3hajA	0.150	0.210	7.767E-3	286	0.070	0.112	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
12	PDB:5ew5A	0.158	0.149	1.249E-2	490	0.051	0.047	5ew5A.pdb.gz
13	PDB:7nsuD	0.145	0.156	2.355E-2	420	0.046	0.050	7nsuD.pdb.gz
14	PDB:6z6oC	0.164	0.140	3.593E-2	548	0.062	0.051	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
15	PDB:2b5uA	0.175	0.171	3.788E-2	470	0.051	0.049	2b5uA.pdb.gz
16	PDB:7z8fe	0.116	0.015	4.210E-2	4579	0.090	0.009	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
17	PDB:4o9yA	0.141	0.037	4.933E-2	2490	0.081	0.015	4o9yA.pdb.gz
18	PDB:4ke2A	0.155	0.325	8.365E-2	196	0.057	0.133	4ke2A.pdb.gz
19	PDB:6sueA	0.177	0.044	9.802E-2	2292	0.079	0.016	6sueA.pdb.gz
20	PDB:5lkiA	0.167	0.060	1.211E-1	1427	0.088	0.028	5lkiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60239	0.0	924	455	1.000	1.000	3BP5_HUMAN SH3 domain-binding protein 5 OS=Homo sapiens OX=9606 GN=SH3BP5 PE=1 SV=2
2	Q91Y80	0.0	822	457	0.923	0.919	3BP5_RAT SH3 domain-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Sh3bp5 PE=1 SV=2
3	Q9Z131	0.0	792	463	0.914	0.898	3BP5_MOUSE SH3 domain-binding protein 5 OS=Mus musculus OX=10090 GN=Sh3bp5 PE=1 SV=3
4	Q9V785	9.80e-67	223	477	0.268	0.256	3BP5H_DROME SH3 domain-binding protein 5 homolog OS=Drosophila melanogaster OX=7227 GN=pcs PE=1 SV=4
5	Q7L8J4	1.27e-58	199	393	0.264	0.305	3BP5L_HUMAN SH3 domain-binding protein 5-like OS=Homo sapiens OX=9606 GN=SH3BP5L PE=1 SV=1
6	P42171	6.03e-10	61.6	244	0.123	0.230	REI1_CAEEL Guanine nucleotide exchange factor rei-1 OS=Caenorhabditis elegans OX=6239 GN=rei-1 PE=1 SV=1
7	C6KSX6	0.076	38.1	1422	0.086	0.027	C6KSX6_PLAF7 Rhoptry protein ROP14 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0613300 PE=3 SV=1
8	P55268	0.42	35.8	1798	0.121	0.031	LAMB2_HUMAN Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=LAMB2 PE=1 SV=2
9	Q5R3Y6	0.80	34.7	527	0.092	0.080	Q5R3Y6_CAEEL Neurabin-1 OS=Caenorhabditis elegans OX=6239 GN=nab-1 PE=1 SV=1
10	Q95Q64	0.87	34.7	561	0.092	0.075	Q95Q64_CAEEL Neurabin-2 OS=Caenorhabditis elegans OX=6239 GN=nab-1 PE=1 SV=1
11	Q80V85	0.88	34.3	475	0.097	0.093	TRI62_MOUSE E3 ubiquitin-protein ligase TRIM62 OS=Mus musculus OX=10090 GN=Trim62 PE=2 SV=1
12	Q8IDX6	0.97	34.7	3130	0.095	0.014	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
13	H2KYW3	1.0	34.3	658	0.105	0.073	H2KYW3_CAEEL Neurabin-1 OS=Caenorhabditis elegans OX=6239 GN=nab-1 PE=1 SV=1
14	H2KYW1	1.3	33.9	721	0.105	0.067	H2KYW1_CAEEL Neurabin-1 OS=Caenorhabditis elegans OX=6239 GN=nab-1 PE=1 SV=1
15	P14105	1.5	33.9	1959	0.064	0.015	MYH9_CHICK Myosin-9 OS=Gallus gallus OX=9031 GN=MYH9 PE=2 SV=1
16	Q8VDD5	1.9	33.5	1960	0.064	0.015	MYH9_MOUSE Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE=1 SV=4
17	P35579	2.1	33.5	1960	0.064	0.015	MYH9_HUMAN Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4
18	Q258K2	2.1	33.5	1960	0.064	0.015	MYH9_CANLF Myosin-9 OS=Canis lupus familiaris OX=9615 GN=MYH9 PE=2 SV=1
19	Q9BVG3	2.7	32.7	475	0.095	0.091	TRI62_HUMAN E3 ubiquitin-protein ligase TRIM62 OS=Homo sapiens OX=9606 GN=TRIM62 PE=1 SV=1
20	Q9CA42	3.6	32.7	1085	0.101	0.042	CRWN3_ARATH Protein CROWDED NUCLEI 3 OS=Arabidopsis thaliana OX=3702 GN=CRWN3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05276 SH3BP5	1.6e-84	294.8	SH3 domain-binding protein 5 (SH3BP5)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373301

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483570	0.993	Tyrosine-protein kinase BTK
2	9606.ENSP00000261890	0.935	Ras-related protein Rab-11A
3	9606.ENSP00000428924	0.924	Tyrosine-protein kinase Lyn
4	9606.ENSP00000364907	0.920	Tyrosine-protein kinase SYK
5	9606.ENSP00000457411	0.910	Ubiquitin carboxyl-terminal hydrolase 10
6	9606.ENSP00000224337	0.908	B-cell linker protein
7	9606.ENSP00000376544	0.906	B-cell antigen receptor complex-associated protein beta chain
8	9606.ENSP00000482457	0.904	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
9	9606.ENSP00000384371	0.903	B-cell lymphoma 6 protein
10	9606.ENSP00000221972	0.900	B-cell antigen receptor complex-associated protein alpha chain
11	9606.ENSP00000303507	0.900	Breakpoint cluster region protein
12	9606.ENSP00000377681	0.764	Ras GTPase-activating protein-binding protein 1
13	9606.ENSP00000378974	0.693	Mitogen-activated protein kinase 8
14	9606.ENSP00000394560	0.637	Mitogen-activated protein kinase 9
15	9606.ENSP00000305721	0.627	Inhibitor of Bruton tyrosine kinase
16	9606.ENSP00000376345	0.627	Growth factor receptor-bound protein 2
17	9606.ENSP00000398655	0.615	Tyrosine-protein kinase ITK/TSK
18	9606.ENSP00000350224	0.613	Cytoplasmic tyrosine-protein kinase BMX
19	9606.ENSP00000264316	0.607	Tyrosine-protein kinase TXK
20	9606.ENSP00000391167	0.603	C-myc promoter-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017124	1.000	SH3 domain binding
GO:0098772	0.881	molecular function regulator activity
GO:0030234	0.802	enzyme regulator activity
GO:0140677	0.557	molecular function activator activity
GO:0140678	0.484	molecular function inhibitor activity
GO:0060589	0.471	nucleoside-triphosphatase regulator activity
GO:0030695	0.454	GTPase regulator activity
GO:0005085	0.343	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0007165	0.988	signal transduction
GO:0035556	0.963	intracellular signal transduction
GO:0019222	0.814	regulation of metabolic process
GO:0031323	0.719	regulation of cellular metabolic process
GO:0060255	0.706	regulation of macromolecule metabolic process
GO:0051171	0.684	regulation of nitrogen compound metabolic process
GO:0080090	0.682	regulation of primary metabolic process
GO:0048519	0.636	negative regulation of biological process
GO:0065009	0.537	regulation of molecular function
GO:0048523	0.497	negative regulation of cellular process
GO:0008152	0.323	metabolic process
GO:0071704	0.309	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0016020	0.988	membrane
GO:0031982	0.944	vesicle
GO:0097708	0.876	intracellular vesicle
GO:0005829	0.874	cytosol
GO:0031410	0.848	cytoplasmic vesicle
GO:0031090	0.510	organelle membrane
GO:0012505	0.401	endomembrane system
GO:0012506	0.372	vesicle membrane
GO:0016604	0.367	nuclear body
GO:0030659	0.353	cytoplasmic vesicle membrane
GO:0005739	0.345	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]