StarFunc result for job id O60241

User Input

>input (1585 residues)
MENTGWMGKGHRMTPACPLLLSVILSLRLATAFDPAPSACSALASGVLYGAFSLQDLFPT
IASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ
AESEVGRPEEEEAEAAAGLELCSGSGPFTFLHFDKNFVQLCLSAEPSEAPRLLAPAALAF
RFVEVLLINNNNSSQFTCGVLCRWSEECGRAAGRACGFAQPGCSCPGEAGAGSTTTTSPG
PPAAHTLSNALVPGGPAPPAEADLHSGSSNDLFTTEMRYGEEPEEEPKVKTQWPRSADEP
GLYMAQTGDPAAEEWSPWSVCSLTCGQGLQVRTRSCVSSPYGTLCSGPLRETRPCNNSAT
CPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAACPVEG
QWLEWGPWGPCSTSCANGTQQRSRKCSVAGPAWATCTGALTDTRECSNLECPATDSKWGP
WNAWSLCSKTCDTGWQRRFRMCQATGTQGYPCEGTGEEVKPCSEKRCPAFHEMCRDEYVM
LMTWKKAAAGEIIYNKCPPNASGSASRRCLLSAQGVAYWGLPSFARCISHEYRYLYLSLR
EHLAKGQRMLAGEGMSQVVRSLQELLARRTYYSGDLLFSVDILRNVTDTFKRATYVPSAD
DVQRFFQVVSFMVDAENKEKWDDAQQVSPGSVHLLRVVEDFIHLVGDALKAFQSSLIVTD
NLVISIQREPVSAVSSDITFPMRGRRGMKDWVRHSEDRLFLPKEVLSLSSPGKPATSGAA
GSPGRGRGPGTVPPGPGHSHQRLLPADPDESSYFVIGAVLYRTLGLILPPPRPPLAVTSR
VMTVTVRPPTQPPAEPLITVELSYIINGTTDPHCASWDYSRADASSGDWDTENCQTLETQ
AAHTRCQCQHLSTFAVLAQPPKDLTLELAGSPSVPLVIGCAVSCMALLTLLAIYAAFWRF
IKSERSIILLNFCLSILASNILILVGQSRVLSKGVCTMTAAFLHFFFLSSFCWVLTEAWQ
SYLAVIGRMRTRLVRKRFLCLGWGLPALVVAVSVGFTRTKGYGTSSYCWLSLEGGLLYAF
VGPAAVIVLVNMLIGIIVFNKLMARDGISDKSKKQRAGSERCPWASLLLPCSACGAVPSP
LLSSASARNAMASLWSSCVVLPLLALTWMSAVLAMTDRRSVLFQALFAVFNSAQGFVITA
VHCFLRREVQDVVKCQMGVCRADESEDSPDSCKNGQLQILSDFEKDVDLACQTVLFKEVN
TCNPSTITGTLSRLSLDEDEEPKSCLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQE
ANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSLQPGGGGGGGEDAPRARPEG
TPRRAAKTVAHTEGYPSFLSVDHSGLGLGPAYGSLQNPYGMTFQPPPPTPSARQVPEPGE
RSRTMPRTVPGSTMKMGSLERKKLRYSDLDFEKVMHTRKRHSELYHELNQKFHTFDRYRS
QSTAKREKRWSVSSGGAAERSVCTDKPSPGERPSLSQHRRHQSWSTFKSMTLGSLPPKPR
ERLTLHRAAAWEPTEPPDGDFQTEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14514	0.239	0.240	0.000	1584	0.426	0.426	O14514.pdb.gz	AGRB1_HUMAN Adhesion G protein-coupled receptor B1 OS=Homo sapiens OX=9606 GN=ADGRB1 PE=1 SV=2
2	AFDB:O60241	0.999	0.999	0.000	1585	1.000	1.000	O60241.pdb.gz	AGRB2_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=2
3	AFDB:O60242	0.268	0.278	0.000	1522	0.471	0.491	O60242.pdb.gz	AGRB3_HUMAN Adhesion G protein-coupled receptor B3 OS=Homo sapiens OX=9606 GN=ADGRB3 PE=1 SV=2
4	AFDB:O94910	0.205	0.215	4.957E-42	1474	0.142	0.153	O94910.pdb.gz	AGRL1_HUMAN Adhesion G protein-coupled receptor L1 OS=Homo sapiens OX=9606 GN=ADGRL1 PE=1 SV=1
5	AFDB:Q9HAR2	0.198	0.216	2.094E-41	1447	0.156	0.171	Q9HAR2.pdb.gz	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
6	AFDB:O88923	0.200	0.212	5.154E-41	1487	0.144	0.154	O88923.pdb.gz	AGRL2_RAT Adhesion G protein-coupled receptor L2 OS=Rattus norvegicus OX=10116 GN=Adgrl2 PE=1 SV=2
7	AFDB:O95490	0.199	0.214	3.910E-40	1459	0.139	0.151	O95490.pdb.gz	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
8	AFDB:A0A2R8QM07	0.195	0.200	4.476E-40	1540	0.154	0.158	A0A2R8QM07.pdb.gz	A0A2R8QM07_DANRE Adhesion G protein-coupled receptor L3 isoform X1 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
9	AFDB:F1R8J2	0.208	0.168	2.354E-38	2014	0.131	0.103	F1R8J2.pdb.gz
10	AFDB:Q9QYP2	0.188	0.143	5.062E-38	2144	0.141	0.104	Q9QYP2.pdb.gz	CELR2_RAT Cadherin EGF LAG seven-pass G-type receptor 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Celsr2 PE=1 SV=1
11	PDB:1w0rA	0.068	0.178	1.401E-12	442	0.052	0.186	1w0rA.pdb.gz
12	PDB:7tynR	0.139	0.513	1.792E-8	373	0.040	0.169	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
13	PDB:7d3sR	0.140	0.710	3.077E-8	266	0.037	0.222	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
14	PDB:4k5yC	0.135	0.739	5.282E-8	248	0.042	0.266	4k5yC.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
15	PDB:6vn7R	0.138	0.715	9.067E-8	263	0.039	0.236	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.
16	PDB:7vqxR	0.142	0.539	1.300E-7	361	0.047	0.208	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
17	PDB:7lciR	0.149	0.509	2.795E-7	393	0.039	0.158	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
18	PDB:6wpwR	0.137	0.478	1.693E-6	398	0.038	0.153	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
19	PDB:7cz5R	0.135	0.673	1.693E-6	269	0.033	0.193	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.
20	PDB:7finR	0.132	0.479	2.218E-6	380	0.044	0.184	7finR.pdb.gz	Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A3C1	0.0	2306	1466	0.719	0.777	A2A3C1_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
2	A2A3C2	0.0	3172	1554	0.980	1.000	A2A3C2_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
3	A2A3C3	0.0	2463	1499	0.760	0.803	A2A3C3_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
4	A2A3C6	0.0	2432	1500	0.751	0.793	A2A3C6_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
5	C0HL12	0.0	1004	1577	0.341	0.343	AGRB1_RAT Adhesion G protein-coupled receptor B1 OS=Rattus norvegicus OX=10116 GN=Adgrb1 PE=1 SV=1
6	O14514	0.0	981	1584	0.342	0.342	AGRB1_HUMAN Adhesion G protein-coupled receptor B1 OS=Homo sapiens OX=9606 GN=ADGRB1 PE=1 SV=2
7	O60241	0.0	3247	1585	1.000	1.000	AGRB2_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=2
8	O60242	0.0	1486	1522	0.489	0.509	AGRB3_HUMAN Adhesion G protein-coupled receptor B3 OS=Homo sapiens OX=9606 GN=ADGRB3 PE=1 SV=2
9	Q3UHD1	0.0	1001	1582	0.336	0.337	AGRB1_MOUSE Adhesion G protein-coupled receptor B1 OS=Mus musculus OX=10090 GN=Adgrb1 PE=1 SV=1
10	Q80ZF8	0.0	1488	1522	0.491	0.512	AGRB3_MOUSE Adhesion G protein-coupled receptor B3 OS=Mus musculus OX=10090 GN=Adgrb3 PE=1 SV=2
11	Q8CGM1	0.0	3081	1561	0.953	0.967	AGRB2_MOUSE Adhesion G protein-coupled receptor B2 OS=Mus musculus OX=10090 GN=Adgrb2 PE=1 SV=2
12	Q9HAR2	1.70e-50	199	1447	0.114	0.125	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
13	Q9Z173	1.40e-49	196	1550	0.116	0.119	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
14	Q80TS3	2.80e-49	195	1537	0.116	0.120	AGRL3_MOUSE Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3
15	A0A6I8PRU0	5.49e-49	195	3019	0.141	0.074	A0A6I8PRU0_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=2
16	Q9NYQ6	5.67e-49	195	3014	0.141	0.074	CELR1_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=1
17	D3YXG0	2.45e-47	190	5634	0.061	0.017	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
18	F1R9W4	2.52e-47	189	3044	0.130	0.068	F1R9W4_DANRE Cadherin EGF LAG seven-pass G-type receptor 1 isoform X2 OS=Danio rerio OX=7955 GN=celsr1a PE=1 SV=3
19	Q96RW7	1.73e-46	187	5635	0.061	0.017	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
20	A0JBX1	5.81e-46	185	2941	0.118	0.064	A0JBX1_DANRE Cadherin EGF LAG seven-pass G-type receptor 2 OS=Danio rerio OX=7955 GN=off-road PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	6.6e+02	11.0	7 transmembrane receptor (rhodopsin family)
2	PF00002 7tm_2	4.6e-61	217.8	7 transmembrane receptor (Secretin family)
3	PF19188 AGRB_N	3.6e-68	240.7	Adhesion GPCR B N-terminal region
4	PF16489 GAIN	5e-34	129.0	GPCR-Autoproteolysis INducing (GAIN) domain
5	PF01825 GPS	1.9e-09	49.3	GPCR proteolysis site, GPS, motif
6	PF19030 TSP1_ADAMTS	2.6e-07	42.1	Thrombospondin type 1 domain
7	PF19035 TSP1_CCN	0.0071	28.0	CCN3 Nov like TSP1 domain
8	PF19028 TSP1_spondin	1.2e-24	97.7	Spondin-like TSP1 domain
9	PF00090 TSP_1	9.2e-35	129.9	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000016226

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000007517	0.681	SH3-domain GRB2-like 2
2	9593.ENSGGOP00000000590	0.647	Ubiquitin associated and SH3 domain containing B
3	9593.ENSGGOP00000009691	0.624	Synaptic Ras GTPase activating protein 1
4	9593.ENSGGOP00000023096	0.568	Neuregulin 1
5	9593.ENSGGOP00000007720	0.542	WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1
6	9593.ENSGGOP00000019008	0.503	WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	0.993	transmembrane signaling receptor activity
GO:0004930	0.980	G protein-coupled receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0050896	0.953	response to stimulus
GO:0032501	0.940	multicellular organismal process
GO:0032502	0.885	developmental process
GO:0048856	0.884	anatomical structure development
GO:0048518	0.867	positive regulation of biological process
GO:0007275	0.828	multicellular organism development
GO:0007186	0.809	G protein-coupled receptor signaling pathway
GO:0048522	0.793	positive regulation of cellular process
GO:0048731	0.730	system development
GO:0051965	0.690	positive regulation of synapse assembly
GO:0007399	0.627	nervous system development
GO:0019932	0.317	second-messenger-mediated signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.399	intracellular anatomical structure
GO:0043231	0.371	intracellular membrane-bounded organelle
GO:0005737	0.311	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]